Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   LS41612_RS22540 Genome accession   NZ_CP019980
Coordinates   4595904..4596413 (-) Length   169 a.a.
NCBI ID   WP_024362647.1    Uniprot ID   -
Organism   Lysinibacillus sphaericus strain DSM 28     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4567965..4609972 4595904..4596413 within 0


Gene organization within MGE regions


Location: 4567965..4609972
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LS41612_RS22325 (LS41612_22305) - 4567965..4568615 (+) 651 WP_024362689.1 hypothetical protein -
  LS41612_RS22330 (LS41612_22310) - 4568676..4568954 (-) 279 WP_024362688.1 hypothetical protein -
  LS41612_RS22335 (LS41612_22315) - 4568935..4569303 (-) 369 WP_024362687.1 hypothetical protein -
  LS41612_RS22340 (LS41612_22320) - 4569296..4569637 (-) 342 WP_051147739.1 YolD-like family protein -
  LS41612_RS22345 (LS41612_22325) - 4569653..4569922 (-) 270 WP_024362685.1 YolD-like family protein -
  LS41612_RS22350 (LS41612_22330) - 4570042..4570725 (-) 684 WP_024362684.1 N-acetylmuramoyl-L-alanine amidase family protein -
  LS41612_RS22355 (LS41612_22335) - 4570722..4571126 (-) 405 WP_158694870.1 holin family protein -
  LS41612_RS23265 - 4571259..4571420 (-) 162 WP_158694871.1 hypothetical protein -
  LS41612_RS22360 (LS41612_22340) - 4571422..4571646 (-) 225 WP_024362682.1 hypothetical protein -
  LS41612_RS22365 (LS41612_22345) - 4571643..4572248 (-) 606 WP_024362681.1 hypothetical protein -
  LS41612_RS22370 (LS41612_22350) - 4572249..4572572 (-) 324 WP_024362680.1 hypothetical protein -
  LS41612_RS22375 (LS41612_22355) - 4572588..4573229 (-) 642 WP_024362679.1 DUF2612 domain-containing protein -
  LS41612_RS22380 (LS41612_22360) - 4573222..4574403 (-) 1182 WP_029747236.1 baseplate J/gp47 family protein -
  LS41612_RS22385 (LS41612_22365) - 4574390..4574743 (-) 354 WP_024362677.1 hypothetical protein -
  LS41612_RS22390 (LS41612_22370) - 4574743..4575207 (-) 465 WP_024362676.1 Gp138 family membrane-puncturing spike protein -
  LS41612_RS22395 (LS41612_22375) - 4575204..4576004 (-) 801 WP_024362675.1 hypothetical protein -
  LS41612_RS22400 (LS41612_22380) - 4575997..4576320 (-) 324 WP_024362674.1 hypothetical protein -
  LS41612_RS22405 (LS41612_22385) - 4576323..4576919 (-) 597 WP_024362673.1 phage baseplate protein -
  LS41612_RS22410 (LS41612_22390) - 4576923..4579058 (-) 2136 WP_024362672.1 hypothetical protein -
  LS41612_RS23395 - 4579055..4579192 (-) 138 WP_162832717.1 hypothetical protein -
  LS41612_RS22415 (LS41612_22395) - 4579239..4579523 (-) 285 WP_137034875.1 hypothetical protein -
  LS41612_RS22420 (LS41612_22400) - 4579624..4580028 (-) 405 WP_024362670.1 hypothetical protein -
  LS41612_RS22425 (LS41612_22405) - 4580042..4581052 (-) 1011 WP_024362669.1 DUF3383 family protein -
  LS41612_RS22430 (LS41612_22410) - 4581052..4581558 (-) 507 WP_024362668.1 hypothetical protein -
  LS41612_RS22435 (LS41612_22415) - 4581551..4581898 (-) 348 WP_024362667.1 hypothetical protein -
  LS41612_RS22440 (LS41612_22420) - 4581895..4582404 (-) 510 WP_024362666.1 hypothetical protein -
  LS41612_RS22445 (LS41612_22425) - 4582408..4582752 (-) 345 WP_024362665.1 phage head-tail connector protein -
  LS41612_RS22450 (LS41612_22430) - 4582706..4583011 (-) 306 WP_024362664.1 hypothetical protein -
  LS41612_RS22455 (LS41612_22435) - 4583068..4583988 (-) 921 WP_024362663.1 phage major capsid protein -
  LS41612_RS22460 (LS41612_22440) - 4584073..4584663 (-) 591 WP_024362662.1 DUF4355 domain-containing protein -
  LS41612_RS22465 (LS41612_22445) - 4584803..4585711 (-) 909 WP_051147738.1 phage minor head protein -
  LS41612_RS22470 (LS41612_22450) - 4585647..4587083 (-) 1437 WP_024362660.1 phage portal protein -
  LS41612_RS22475 (LS41612_22455) - 4587094..4588260 (-) 1167 WP_036205164.1 PBSX family phage terminase large subunit -
  LS41612_RS22480 (LS41612_22460) terS 4588293..4589081 (-) 789 WP_024362658.1 phage terminase small subunit -
  LS41612_RS22485 (LS41612_22465) - 4589392..4589679 (-) 288 WP_024362657.1 DUF2829 domain-containing protein -
  LS41612_RS22490 (LS41612_22470) - 4590600..4591370 (-) 771 WP_024362656.1 hypothetical protein -
  LS41612_RS22495 (LS41612_22475) - 4591372..4591665 (-) 294 WP_051147737.1 hypothetical protein -
  LS41612_RS22500 (LS41612_22480) - 4591649..4592785 (-) 1137 WP_024362655.1 hypothetical protein -
  LS41612_RS22505 (LS41612_22485) - 4592922..4593335 (-) 414 WP_024362654.1 LuxR C-terminal-related transcriptional regulator -
  LS41612_RS22510 (LS41612_22490) - 4593636..4593848 (-) 213 WP_024362653.1 hypothetical protein -
  LS41612_RS22515 (LS41612_22495) - 4594043..4594297 (-) 255 WP_024362652.1 hypothetical protein -
  LS41612_RS22520 (LS41612_22500) - 4594282..4594704 (-) 423 WP_024362651.1 RusA family crossover junction endodeoxyribonuclease -
  LS41612_RS22525 (LS41612_22505) - 4594701..4595351 (-) 651 WP_024362650.1 hypothetical protein -
  LS41612_RS22530 (LS41612_22510) - 4595429..4595668 (-) 240 WP_024362649.1 hypothetical protein -
  LS41612_RS22540 (LS41612_22520) ssbA 4595904..4596413 (-) 510 WP_024362647.1 single-stranded DNA-binding protein Machinery gene
  LS41612_RS22545 (LS41612_22525) - 4596410..4596685 (-) 276 WP_024362646.1 hypothetical protein -
  LS41612_RS22550 (LS41612_22530) - 4596682..4596978 (-) 297 WP_024362645.1 YopX family protein -
  LS41612_RS22555 (LS41612_22535) - 4597058..4597246 (-) 189 WP_024362644.1 hypothetical protein -
  LS41612_RS22560 (LS41612_22540) - 4597239..4597667 (-) 429 WP_137034874.1 hypothetical protein -
  LS41612_RS22565 (LS41612_22545) - 4597671..4598228 (-) 558 WP_024362642.1 hypothetical protein -
  LS41612_RS22570 (LS41612_22550) - 4598245..4598430 (-) 186 WP_024362641.1 hypothetical protein -
  LS41612_RS22575 (LS41612_22555) - 4598466..4599305 (-) 840 WP_233433822.1 DnaA ATPase domain-containing protein -
  LS41612_RS22580 (LS41612_22560) - 4599220..4600011 (-) 792 WP_024362639.1 DnaD domain protein -
  LS41612_RS22585 (LS41612_22565) - 4600027..4600395 (-) 369 WP_024362638.1 hypothetical protein -
  LS41612_RS22590 (LS41612_22570) - 4600445..4600972 (-) 528 WP_024362637.1 hypothetical protein -
  LS41612_RS22595 (LS41612_22575) - 4601028..4601231 (-) 204 WP_024362636.1 helix-turn-helix transcriptional regulator -
  LS41612_RS22600 (LS41612_22580) - 4601407..4602219 (-) 813 WP_024362635.1 recombinase RecT -
  LS41612_RS22605 (LS41612_22585) - 4602222..4602401 (-) 180 WP_024362634.1 hypothetical protein -
  LS41612_RS22610 (LS41612_22590) - 4602404..4603345 (-) 942 WP_029747222.1 YqaJ viral recombinase family protein -
  LS41612_RS22615 (LS41612_22595) - 4603415..4603693 (-) 279 WP_024362632.1 hypothetical protein -
  LS41612_RS22620 (LS41612_22600) - 4603705..4604010 (-) 306 WP_024362631.1 hypothetical protein -
  LS41612_RS22625 (LS41612_22605) - 4604297..4604548 (-) 252 WP_024362630.1 hypothetical protein -
  LS41612_RS22630 (LS41612_22610) - 4604545..4605030 (-) 486 WP_233433823.1 XRE family transcriptional regulator -
  LS41612_RS22635 (LS41612_22615) - 4605230..4605526 (-) 297 WP_024362628.1 hypothetical protein -
  LS41612_RS22640 (LS41612_22620) - 4605549..4605788 (-) 240 WP_024362627.1 hypothetical protein -
  LS41612_RS22645 (LS41612_22625) - 4605788..4606543 (-) 756 WP_036205146.1 Rha family transcriptional regulator -
  LS41612_RS22650 (LS41612_22630) - 4606614..4606859 (-) 246 WP_024362625.1 hypothetical protein -
  LS41612_RS22655 (LS41612_22635) - 4606910..4607215 (+) 306 WP_024362624.1 hypothetical protein -
  LS41612_RS23270 - 4607196..4607360 (-) 165 WP_158694872.1 hypothetical protein -
  LS41612_RS22660 (LS41612_22640) - 4607412..4607633 (-) 222 WP_024362623.1 helix-turn-helix transcriptional regulator -
  LS41612_RS22665 (LS41612_22645) - 4607798..4608262 (+) 465 WP_024362622.1 helix-turn-helix domain-containing protein -
  LS41612_RS22670 (LS41612_22650) - 4608288..4608728 (+) 441 WP_024362621.1 ImmA/IrrE family metallo-endopeptidase -
  LS41612_RS22675 (LS41612_22655) - 4608773..4609972 (+) 1200 WP_024362620.1 site-specific integrase -

Sequence

Protein


Download         Length: 169 a.a.        Molecular weight: 18630.54 Da        Isoelectric Point: 5.9192

>NTDB_id=219517 LS41612_RS22540 WP_024362647.1 4595904..4596413(-) (ssbA) [Lysinibacillus sphaericus strain DSM 28]
MINRVVLVGRLTKDPELRYTPNGIASCRFTVAVNRAFNKEGEEKQADFISCVAWRKQAENLANFMKKGNLIGLEGRIQTG
SYEGHDGKRVYTTDVVADSIQFLELRNSTGGAQSTPNYQSSTNTGGTYQNPPQGNYGGNNNQPSYTRVDEDPFANSKGPI
EVSQDDLPF

Nucleotide


Download         Length: 510 bp        

>NTDB_id=219517 LS41612_RS22540 WP_024362647.1 4595904..4596413(-) (ssbA) [Lysinibacillus sphaericus strain DSM 28]
ATGATCAACCGTGTCGTGCTAGTTGGCCGATTAACAAAAGATCCTGAATTACGATACACACCGAACGGCATTGCATCATG
TCGTTTCACAGTAGCCGTAAATCGTGCATTTAACAAAGAGGGCGAAGAAAAACAAGCTGACTTCATTAGCTGTGTAGCTT
GGCGAAAGCAGGCCGAGAATCTAGCTAACTTCATGAAAAAAGGAAATTTAATAGGTTTGGAAGGGCGAATCCAAACAGGC
AGCTATGAGGGGCATGATGGCAAGCGTGTATACACTACTGACGTTGTAGCCGATAGCATCCAATTCTTAGAGCTGAGAAA
CAGCACAGGAGGCGCACAGAGCACGCCAAACTATCAATCTAGTACAAATACAGGTGGAACGTATCAAAACCCACCACAGG
GCAATTACGGCGGTAATAATAACCAACCAAGTTATACGAGAGTGGATGAAGATCCATTTGCTAATAGTAAAGGGCCGATT
GAGGTTAGTCAGGACGATTTGCCTTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

51.744

100

0.527
  ssb Latilactobacillus sakei subsp. sakei 23K

47.429

100

0.491
  ssb Neisseria meningitidis MC58

36.158

100

0.379
  ssb Neisseria gonorrhoeae MS11

36.158

100

0.379

Multiple sequence alignment