Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilL   Type   Machinery gene
Locus tag   BZG33_RS03345 Genome accession   NZ_CP019466
Coordinates   565570..566043 (+) Length   157 a.a.
NCBI ID   WP_012503482.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain RIVM0610     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 561054..604401 565570..566043 within 0


Gene organization within MGE regions


Location: 561054..604401
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BZG33_RS03320 (BZG33_03260) dnaB 561054..562457 (+) 1404 WP_012503477.1 replicative DNA helicase -
  BZG33_RS03325 (BZG33_03265) pilH 562714..563376 (+) 663 WP_047916986.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  BZG33_RS03330 (BZG33_03270) pilI 563408..564022 (+) 615 WP_012503479.1 type IV pilus modification protein PilV Machinery gene
  BZG33_RS03335 (BZG33_03275) pilJ 564019..564981 (+) 963 WP_047921846.1 PilW family protein Machinery gene
  BZG33_RS03340 (BZG33_03280) pilK 564960..565568 (+) 609 WP_047921847.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  BZG33_RS03345 (BZG33_03285) pilL 565570..566043 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  BZG33_RS03350 (BZG33_03290) - 566113..566421 (-) 309 WP_003706588.1 AzlD family protein -
  BZG33_RS03355 (BZG33_03295) - 566418..567129 (-) 712 Protein_562 AzlC family ABC transporter permease -
  BZG33_RS03360 (BZG33_03300) dut 567295..567747 (+) 453 WP_003701071.1 dUTP diphosphatase -
  BZG33_RS03365 (BZG33_03305) dapC 567819..569006 (+) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  BZG33_RS03370 (BZG33_03310) yaaA 569162..569941 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  BZG33_RS03385 (BZG33_03325) - 570471..571671 (+) 1201 Protein_566 tyrosine-type recombinase/integrase -
  BZG33_RS03400 (BZG33_03335) - 572027..572296 (-) 270 WP_003687928.1 hypothetical protein -
  BZG33_RS03405 (BZG33_03340) - 572491..573174 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  BZG33_RS14580 - 573488..573721 (-) 234 Protein_569 hypothetical protein -
  BZG33_RS03415 (BZG33_03350) - 573832..574047 (-) 216 WP_003691538.1 hypothetical protein -
  BZG33_RS03420 (BZG33_03355) - 574099..574590 (-) 492 WP_047916888.1 siphovirus Gp157 family protein -
  BZG33_RS03425 (BZG33_03360) - 574587..574769 (-) 183 WP_003691535.1 hypothetical protein -
  BZG33_RS03430 (BZG33_03365) - 574909..575595 (-) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  BZG33_RS03435 (BZG33_03370) - 575664..575825 (-) 162 WP_003693867.1 hypothetical protein -
  BZG33_RS03440 (BZG33_03375) - 575822..576100 (-) 279 WP_003691529.1 NGO1622 family putative holin -
  BZG33_RS03445 (BZG33_03380) - 576253..576585 (-) 333 WP_003705604.1 hypothetical protein -
  BZG33_RS03450 (BZG33_03385) - 576726..577013 (-) 288 WP_041421246.1 hypothetical protein -
  BZG33_RS03455 (BZG33_03390) - 577010..577486 (-) 477 WP_002255718.1 hypothetical protein -
  BZG33_RS03460 (BZG33_03395) - 577519..577719 (-) 201 WP_047920246.1 hypothetical protein -
  BZG33_RS03465 (BZG33_03400) - 578203..578421 (+) 219 WP_003691731.1 hypothetical protein -
  BZG33_RS03470 (BZG33_03405) - 578438..578797 (-) 360 WP_003691733.1 hypothetical protein -
  BZG33_RS03475 (BZG33_03410) - 578798..579337 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  BZG33_RS03480 (BZG33_03415) - 579497..580213 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  BZG33_RS03490 (BZG33_03425) - 580594..580821 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  BZG33_RS03495 (BZG33_03430) - 580939..582003 (+) 1065 WP_050154181.1 hypothetical protein -
  BZG33_RS03500 (BZG33_03435) - 582000..583361 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  BZG33_RS03505 (BZG33_03440) - 583398..583661 (+) 264 WP_154235845.1 hypothetical protein -
  BZG33_RS03510 (BZG33_03445) - 583700..584194 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  BZG33_RS03515 (BZG33_03450) - 584371..584520 (+) 150 WP_003689110.1 hypothetical protein -
  BZG33_RS14085 - 584549..584830 (+) 282 WP_003689109.1 hypothetical protein -
  BZG33_RS03520 (BZG33_03455) - 584821..585258 (+) 438 WP_047918627.1 RusA family crossover junction endodeoxyribonuclease -
  BZG33_RS03525 (BZG33_03460) - 585251..585556 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  BZG33_RS03530 (BZG33_03465) - 585553..585936 (+) 384 WP_003690918.1 recombination protein NinB -
  BZG33_RS03535 (BZG33_03470) - 585927..586445 (+) 519 WP_003687984.1 HNH endonuclease -
  BZG33_RS03540 (BZG33_03475) - 586510..586932 (+) 423 WP_003690919.1 hypothetical protein -
  BZG33_RS14090 - 586932..587471 (+) 540 WP_003690920.1 hypothetical protein -
  BZG33_RS03555 (BZG33_03490) - 587452..588726 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  BZG33_RS03560 (BZG33_03495) - 588711..590978 (+) 2268 WP_229689248.1 hypothetical protein -
  BZG33_RS03565 (BZG33_03500) - 591215..592411 (+) 1197 WP_003687992.1 hypothetical protein -
  BZG33_RS03570 (BZG33_03505) - 592408..593847 (+) 1440 WP_050153730.1 hypothetical protein -
  BZG33_RS14095 - 596538..599642 (+) 3105 Protein_601 PLxRFG domain-containing protein -
  BZG33_RS14100 (BZG33_03515) - 599624..600361 (+) 738 WP_003690932.1 hypothetical protein -
  BZG33_RS03585 (BZG33_03520) - 600382..601677 (+) 1296 WP_003690933.1 DUF4043 family protein -
  BZG33_RS03590 (BZG33_03525) - 601732..602205 (+) 474 WP_003690936.1 hypothetical protein -
  BZG33_RS03595 (BZG33_03530) - 602211..602696 (+) 486 WP_003687997.1 hypothetical protein -
  BZG33_RS03600 (BZG33_03535) - 602693..603367 (+) 675 WP_003687998.1 hypothetical protein -
  BZG33_RS03605 (BZG33_03540) - 603370..603519 (+) 150 WP_003706419.1 hypothetical protein -
  BZG33_RS03610 (BZG33_03545) - 603556..604401 (-) 846 WP_047921371.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17486.30 Da        Isoelectric Point: 9.9561

>NTDB_id=215964 BZG33_RS03345 WP_012503482.1 565570..566043(+) (pilL) [Neisseria gonorrhoeae strain RIVM0610]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=215964 BZG33_RS03345 WP_012503482.1 565570..566043(+) (pilL) [Neisseria gonorrhoeae strain RIVM0610]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

91.72

100

0.917

  pilX Neisseria meningitidis 8013

85.35

100

0.854


Multiple sequence alignment