Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MCA_RS13180 | Genome accession | NC_002977 |
| Coordinates | 2877665..2878183 (-) | Length | 172 a.a. |
| NCBI ID | WP_010961902.1 | Uniprot ID | Q603V6 |
| Organism | Methylococcus capsulatus str. Bath | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2817934..2878183 | 2877665..2878183 | within | 0 |
| IScluster/Tn | 2873899..2877013 | 2877665..2878183 | flank | 652 |
Gene organization within MGE regions
Location: 2817934..2878183
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MCA_RS12880 | - | 2817934..2818401 (+) | 468 | WP_017364127.1 | hypothetical protein | - |
| MCA_RS12885 (MCA2632) | - | 2819179..2819643 (-) | 465 | WP_010961845.1 | hypothetical protein | - |
| MCA_RS12890 (MCA2633) | - | 2819640..2820023 (-) | 384 | WP_010961846.1 | hypothetical protein | - |
| MCA_RS12895 (MCA2634) | - | 2820020..2821399 (-) | 1380 | WP_010961847.1 | recombinase family protein | - |
| MCA_RS12900 (MCA2635) | - | 2821399..2821842 (-) | 444 | WP_010961848.1 | DUF2924 domain-containing protein | - |
| MCA_RS12905 (MCA2636) | - | 2821842..2822033 (-) | 192 | WP_041361328.1 | hypothetical protein | - |
| MCA_RS12910 (MCA2637) | - | 2822119..2824365 (-) | 2247 | WP_010961850.1 | hypothetical protein | - |
| MCA_RS12915 (MCA2638) | - | 2824384..2824956 (-) | 573 | WP_010961851.1 | PIN domain-containing protein | - |
| MCA_RS12920 (MCA2639) | - | 2824961..2825422 (-) | 462 | WP_010961852.1 | helix-turn-helix domain-containing protein | - |
| MCA_RS12925 (MCA2640) | - | 2825651..2825914 (+) | 264 | WP_010961853.1 | helix-turn-helix transcriptional regulator | - |
| MCA_RS12930 (MCA2641) | - | 2825925..2826404 (+) | 480 | WP_010961854.1 | hypothetical protein | - |
| MCA_RS12935 (MCA2642) | - | 2826408..2827166 (+) | 759 | WP_010961855.1 | BRO-N domain-containing protein | - |
| MCA_RS12940 (MCA2643) | - | 2827166..2827984 (+) | 819 | WP_010961856.1 | ATP-binding protein | - |
| MCA_RS12945 (MCA2644) | - | 2827988..2828614 (+) | 627 | WP_010961857.1 | hypothetical protein | - |
| MCA_RS12950 (MCA2645) | - | 2828676..2829149 (+) | 474 | WP_010961858.1 | DUF6511 domain-containing protein | - |
| MCA_RS12955 (MCA2646) | - | 2829149..2829877 (+) | 729 | WP_010961859.1 | PD-(D/E)XK nuclease family protein | - |
| MCA_RS12960 (MCA2647) | - | 2829881..2830153 (+) | 273 | WP_010961860.1 | hypothetical protein | - |
| MCA_RS12965 (MCA2648) | - | 2830150..2832417 (+) | 2268 | WP_010961861.1 | phage/plasmid primase, P4 family | - |
| MCA_RS12970 (MCA2649) | - | 2832553..2833029 (+) | 477 | WP_010961862.1 | crossover junction endodeoxyribonuclease RuvC | - |
| MCA_RS12975 (MCA2650) | - | 2833031..2833240 (+) | 210 | WP_010961863.1 | hypothetical protein | - |
| MCA_RS12980 (MCA2651) | - | 2833233..2833649 (+) | 417 | WP_010961864.1 | DUF6362 family protein | - |
| MCA_RS12985 (MCA2652) | - | 2833646..2833882 (+) | 237 | WP_010961865.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| MCA_RS12990 (MCA2653) | - | 2833879..2834214 (+) | 336 | WP_010961866.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MCA_RS12995 (MCA2654) | - | 2834580..2836010 (+) | 1431 | WP_228370212.1 | site-specific DNA-methyltransferase | - |
| MCA_RS13000 (MCA2655) | - | 2836007..2837272 (+) | 1266 | WP_010961868.1 | site-specific DNA-methyltransferase | - |
| MCA_RS13005 (MCA2656) | - | 2837239..2837829 (-) | 591 | WP_010961869.1 | DUF3489 domain-containing protein | - |
| MCA_RS13010 (MCA2657) | - | 2837940..2838476 (+) | 537 | WP_010961870.1 | hypothetical protein | - |
| MCA_RS13015 (MCA2658) | - | 2838476..2840446 (+) | 1971 | WP_010961871.1 | phage terminase large subunit family protein | - |
| MCA_RS13020 (MCA2659) | - | 2840454..2840660 (+) | 207 | WP_010961872.1 | phage head-tail joining protein | - |
| MCA_RS13025 (MCA2660) | - | 2840660..2842168 (+) | 1509 | WP_010961873.1 | phage portal protein | - |
| MCA_RS13030 (MCA2661) | - | 2842178..2843404 (+) | 1227 | WP_010961874.1 | S49 family peptidase | - |
| MCA_RS13035 (MCA2662) | - | 2843406..2843783 (+) | 378 | WP_010961875.1 | head decoration protein | - |
| MCA_RS13040 (MCA2663) | - | 2843786..2844802 (+) | 1017 | WP_010961876.1 | major capsid protein | - |
| MCA_RS13045 (MCA2664) | - | 2844799..2845101 (+) | 303 | WP_010961877.1 | head-tail joining protein | - |
| MCA_RS13050 (MCA2665) | - | 2845105..2845551 (+) | 447 | WP_010961878.1 | hypothetical protein | - |
| MCA_RS13055 (MCA2666) | - | 2845558..2845758 (+) | 201 | WP_010961879.1 | DUF7210 family protein | - |
| MCA_RS13060 (MCA2667) | - | 2845755..2846507 (+) | 753 | WP_010961880.1 | hypothetical protein | - |
| MCA_RS13065 (MCA2668) | - | 2846521..2846916 (+) | 396 | WP_010961881.1 | hypothetical protein | - |
| MCA_RS13070 (MCA2669) | - | 2847097..2847741 (+) | 645 | WP_041361330.1 | DUF6441 family protein | - |
| MCA_RS13075 (MCA2670) | - | 2847759..2851790 (+) | 4032 | WP_010961883.1 | tape measure protein | - |
| MCA_RS13080 (MCA2671) | - | 2851801..2852208 (+) | 408 | WP_041361331.1 | hypothetical protein | - |
| MCA_RS13085 (MCA2672) | - | 2852211..2855795 (+) | 3585 | WP_010961885.1 | hypothetical protein | - |
| MCA_RS13090 (MCA2673) | - | 2855819..2857087 (+) | 1269 | WP_010961886.1 | hypothetical protein | - |
| MCA_RS13095 (MCA2674) | - | 2857091..2858176 (+) | 1086 | WP_010961887.1 | hypothetical protein | - |
| MCA_RS13100 (MCA2675) | - | 2858173..2858568 (+) | 396 | WP_010961888.1 | hypothetical protein | - |
| MCA_RS13105 (MCA2676) | - | 2858572..2860530 (+) | 1959 | WP_010961889.1 | hypothetical protein | - |
| MCA_RS13110 (MCA2677) | - | 2860523..2860744 (+) | 222 | WP_010961890.1 | hypothetical protein | - |
| MCA_RS13115 (MCA2678) | - | 2860831..2861133 (+) | 303 | WP_010961891.1 | DUF6127 family protein | - |
| MCA_RS13120 (MCA2679) | - | 2861130..2861606 (+) | 477 | WP_010961892.1 | hypothetical protein | - |
| MCA_RS13125 (MCA2680) | - | 2861603..2862061 (+) | 459 | WP_010961893.1 | lysozyme | - |
| MCA_RS13130 (MCA2681) | - | 2862062..2863366 (-) | 1305 | WP_041361332.1 | hypothetical protein | - |
| MCA_RS13135 (MCA2682) | - | 2863366..2866143 (-) | 2778 | WP_010961895.1 | DEAD/DEAH box helicase | - |
| MCA_RS13140 (MCA2683) | - | 2866153..2866653 (-) | 501 | WP_010961896.1 | hypothetical protein | - |
| MCA_RS13145 (MCA2684) | - | 2866650..2869874 (-) | 3225 | WP_050738217.1 | DUF1156 domain-containing protein | - |
| MCA_RS13150 (MCA2685) | - | 2869886..2870875 (-) | 990 | WP_010961898.1 | hypothetical protein | - |
| MCA_RS13155 (MCA2686) | - | 2870875..2873616 (-) | 2742 | WP_010961899.1 | DUF499 domain-containing protein | - |
| MCA_RS13160 | - | 2873616..2873861 (-) | 246 | WP_050738218.1 | helix-turn-helix domain-containing protein | - |
| MCA_RS13165 (MCA2687) | - | 2873899..2874999 (+) | 1101 | WP_010959422.1 | IS5-like element ISMca1 family transposase | - |
| MCA_RS13170 (MCA2688) | - | 2875638..2875922 (+) | 285 | WP_143708555.1 | hypothetical protein | - |
| MCA_RS13175 (MCA2689) | - | 2875925..2877013 (-) | 1089 | WP_010961901.1 | IS3-like element ISMca4 family transposase | - |
| MCA_RS13180 (MCA2690) | ssb | 2877665..2878183 (-) | 519 | WP_010961902.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 172 a.a. Molecular weight: 18195.01 Da Isoelectric Point: 5.2882
>NTDB_id=21453 MCA_RS13180 WP_010961902.1 2877665..2878183(-) (ssb) [Methylococcus capsulatus str. Bath]
MASRGVNKVILIGNLGADPEVRYMPNGGAVANLRIATSESWKDQQTGQTQERTEWHSVVLYRRLAEIAGEYLKKGSKVYI
EGSLRTRKWQDKNTGQDRYATEIIGNEMQMLDRAGGGMGGGMGVGEPDWDAPPAGGGSRPRSSGGGHGGGSTGGSGAGSS
QFDEGFDDDVPF
MASRGVNKVILIGNLGADPEVRYMPNGGAVANLRIATSESWKDQQTGQTQERTEWHSVVLYRRLAEIAGEYLKKGSKVYI
EGSLRTRKWQDKNTGQDRYATEIIGNEMQMLDRAGGGMGGGMGVGEPDWDAPPAGGGSRPRSSGGGHGGGSTGGSGAGSS
QFDEGFDDDVPF
Nucleotide
Download Length: 519 bp
>NTDB_id=21453 MCA_RS13180 WP_010961902.1 2877665..2878183(-) (ssb) [Methylococcus capsulatus str. Bath]
ATGGCCAGTCGAGGCGTCAACAAAGTCATACTCATCGGCAATCTGGGCGCAGATCCGGAAGTGCGTTACATGCCGAACGG
TGGCGCGGTCGCCAATCTGCGCATTGCCACTAGCGAGTCCTGGAAAGATCAACAGACCGGTCAGACCCAGGAGCGTACCG
AATGGCACAGCGTGGTGTTGTACCGCCGGCTGGCGGAAATCGCCGGCGAATATCTCAAGAAAGGCAGCAAGGTCTATATT
GAAGGCAGCCTCCGGACCCGCAAATGGCAGGACAAGAACACCGGCCAGGACCGCTATGCCACGGAAATCATCGGTAATGA
GATGCAGATGCTCGACCGTGCCGGGGGAGGGATGGGCGGCGGCATGGGCGTGGGCGAACCCGACTGGGATGCGCCGCCTG
CGGGGGGCGGCTCCCGGCCGCGCAGTTCGGGTGGCGGTCATGGCGGTGGCAGTACCGGCGGGAGCGGTGCCGGAAGCAGC
CAGTTCGACGAAGGGTTCGACGACGACGTGCCGTTTTGA
ATGGCCAGTCGAGGCGTCAACAAAGTCATACTCATCGGCAATCTGGGCGCAGATCCGGAAGTGCGTTACATGCCGAACGG
TGGCGCGGTCGCCAATCTGCGCATTGCCACTAGCGAGTCCTGGAAAGATCAACAGACCGGTCAGACCCAGGAGCGTACCG
AATGGCACAGCGTGGTGTTGTACCGCCGGCTGGCGGAAATCGCCGGCGAATATCTCAAGAAAGGCAGCAAGGTCTATATT
GAAGGCAGCCTCCGGACCCGCAAATGGCAGGACAAGAACACCGGCCAGGACCGCTATGCCACGGAAATCATCGGTAATGA
GATGCAGATGCTCGACCGTGCCGGGGGAGGGATGGGCGGCGGCATGGGCGTGGGCGAACCCGACTGGGATGCGCCGCCTG
CGGGGGGCGGCTCCCGGCCGCGCAGTTCGGGTGGCGGTCATGGCGGTGGCAGTACCGGCGGGAGCGGTGCCGGAAGCAGC
CAGTTCGACGAAGGGTTCGACGACGACGTGCCGTTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
54.301 |
100 |
0.587 |
| ssb | Glaesserella parasuis strain SC1401 |
51.648 |
100 |
0.547 |
| ssb | Neisseria meningitidis MC58 |
45.714 |
100 |
0.465 |
| ssb | Neisseria gonorrhoeae MS11 |
45.143 |
100 |
0.459 |