Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | BRW83_RS06915 | Genome accession | NZ_CP018787 |
| Coordinates | 1445461..1445910 (+) | Length | 149 a.a. |
| NCBI ID | WP_086131796.1 | Uniprot ID | - |
| Organism | Oxalobacter formigenes strain HC-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1409703..1447782 | 1445461..1445910 | within | 0 |
Gene organization within MGE regions
Location: 1409703..1447782
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BRW83_RS06665 (BRW83_1324) | - | 1409703..1410599 (-) | 897 | WP_005880559.1 | alpha/beta hydrolase | - |
| BRW83_RS06675 (BRW83_1326) | - | 1410982..1411959 (+) | 978 | WP_086131752.1 | tyrosine-type recombinase/integrase | - |
| BRW83_RS06680 (BRW83_1327) | - | 1412077..1412511 (-) | 435 | WP_086131753.1 | hypothetical protein | - |
| BRW83_RS06685 (BRW83_1328) | - | 1412542..1413048 (-) | 507 | WP_086131754.1 | lysozyme | - |
| BRW83_RS11690 | - | 1413141..1413359 (+) | 219 | WP_157661012.1 | hypothetical protein | - |
| BRW83_RS06700 (BRW83_1331) | - | 1413495..1414121 (-) | 627 | WP_086131757.1 | hypothetical protein | - |
| BRW83_RS06705 (BRW83_1332) | - | 1414124..1414660 (-) | 537 | WP_198341920.1 | hypothetical protein | - |
| BRW83_RS06710 (BRW83_1333) | - | 1414673..1417273 (-) | 2601 | WP_086131758.1 | host specificity factor TipJ family phage tail protein | - |
| BRW83_RS06715 (BRW83_1334) | - | 1417354..1417842 (+) | 489 | WP_036602557.1 | membrane lipoprotein lipid attachment site-containing protein | - |
| BRW83_RS06720 (BRW83_1335) | - | 1417816..1418169 (-) | 354 | WP_157661013.1 | NlpC/P60 family protein | - |
| BRW83_RS06725 (BRW83_1336) | - | 1418199..1418723 (-) | 525 | WP_086131760.1 | DUF1833 family protein | - |
| BRW83_RS06730 (BRW83_1337) | - | 1418716..1419111 (-) | 396 | WP_086131761.1 | hypothetical protein | - |
| BRW83_RS06735 (BRW83_1338) | - | 1419111..1421654 (-) | 2544 | WP_086131762.1 | phage tail length tape measure family protein | - |
| BRW83_RS06740 (BRW83_1339) | - | 1421644..1422036 (-) | 393 | WP_331282803.1 | DUF1799 domain-containing protein | - |
| BRW83_RS06745 (BRW83_1340) | - | 1422033..1422359 (-) | 327 | WP_086131764.1 | hypothetical protein | - |
| BRW83_RS06750 (BRW83_1341) | - | 1422369..1423301 (-) | 933 | WP_086131765.1 | phage tail tube protein | - |
| BRW83_RS06755 (BRW83_1342) | - | 1423315..1423722 (-) | 408 | WP_086131766.1 | hypothetical protein | - |
| BRW83_RS06760 (BRW83_1343) | - | 1423719..1424024 (-) | 306 | WP_086131767.1 | head-tail joining protein | - |
| BRW83_RS06765 (BRW83_1344) | - | 1424024..1424374 (-) | 351 | WP_086131826.1 | DUF2190 family protein | - |
| BRW83_RS06770 (BRW83_1345) | - | 1424457..1426493 (-) | 2037 | WP_086131768.1 | prohead protease/major capsid protein fusion protein | - |
| BRW83_RS06775 (BRW83_1346) | - | 1426555..1428006 (-) | 1452 | WP_086131769.1 | phage portal protein | - |
| BRW83_RS06780 (BRW83_1347) | - | 1428010..1428228 (-) | 219 | WP_086131770.1 | phage head-tail joining protein | - |
| BRW83_RS06785 (BRW83_1348) | - | 1428237..1430372 (-) | 2136 | WP_086131771.1 | phage terminase large subunit family protein | - |
| BRW83_RS06790 (BRW83_1349) | - | 1430365..1430967 (-) | 603 | WP_086131772.1 | hypothetical protein | - |
| BRW83_RS06795 (BRW83_1350) | - | 1431157..1431924 (-) | 768 | WP_145814968.1 | hypothetical protein | - |
| BRW83_RS06800 (BRW83_1351) | - | 1431978..1432757 (-) | 780 | WP_145814967.1 | hypothetical protein | - |
| BRW83_RS06805 (BRW83_1352) | - | 1433065..1433424 (-) | 360 | WP_086131775.1 | antiterminator Q family protein | - |
| BRW83_RS06815 (BRW83_1353) | - | 1433747..1436260 (-) | 2514 | WP_086131777.1 | DUF5906 domain-containing protein | - |
| BRW83_RS06820 (BRW83_1354) | - | 1436253..1437098 (-) | 846 | WP_086131778.1 | KilA-N domain-containing protein | - |
| BRW83_RS06825 (BRW83_1355) | - | 1437091..1437813 (-) | 723 | WP_086131779.1 | Bro-N domain-containing protein | - |
| BRW83_RS06830 (BRW83_1356) | - | 1437905..1438198 (+) | 294 | WP_086131780.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| BRW83_RS06835 (BRW83_1357) | - | 1438202..1438486 (+) | 285 | WP_086131781.1 | addiction module antidote protein | - |
| BRW83_RS06840 (BRW83_1358) | - | 1438513..1438908 (-) | 396 | WP_086131782.1 | winged helix-turn-helix domain-containing protein | - |
| BRW83_RS11695 | - | 1438905..1439045 (-) | 141 | WP_157661014.1 | hypothetical protein | - |
| BRW83_RS06850 (BRW83_1360) | - | 1439212..1439670 (-) | 459 | WP_086131784.1 | YmfL family putative regulatory protein | - |
| BRW83_RS11870 | - | 1439696..1439920 (-) | 225 | WP_186447524.1 | hypothetical protein | - |
| BRW83_RS06860 (BRW83_1361) | - | 1439975..1440364 (+) | 390 | WP_198341921.1 | helix-turn-helix domain-containing protein | - |
| BRW83_RS06865 (BRW83_1362) | - | 1440573..1441103 (+) | 531 | WP_145814966.1 | hypothetical protein | - |
| BRW83_RS11700 (BRW83_1363) | - | 1441112..1441252 (+) | 141 | WP_157661015.1 | hypothetical protein | - |
| BRW83_RS06870 (BRW83_1364) | - | 1441256..1441435 (+) | 180 | WP_086131788.1 | hypothetical protein | - |
| BRW83_RS11875 (BRW83_1365) | - | 1441445..1442221 (+) | 777 | WP_198341922.1 | DUF3310 domain-containing protein | - |
| BRW83_RS06880 (BRW83_1366) | - | 1442211..1442570 (+) | 360 | WP_086131789.1 | DUF4406 domain-containing protein | - |
| BRW83_RS06890 (BRW83_1368) | - | 1442758..1443795 (+) | 1038 | WP_086131791.1 | DUF5131 family protein | - |
| BRW83_RS06895 (BRW83_1369) | - | 1443792..1444016 (+) | 225 | WP_086131792.1 | hypothetical protein | - |
| BRW83_RS06900 (BRW83_1370) | - | 1444003..1444377 (+) | 375 | WP_086131793.1 | hypothetical protein | - |
| BRW83_RS06905 (BRW83_1371) | - | 1444374..1445006 (+) | 633 | WP_086131794.1 | hypothetical protein | - |
| BRW83_RS06910 (BRW83_1372) | - | 1445003..1445458 (+) | 456 | WP_086131795.1 | class I SAM-dependent methyltransferase | - |
| BRW83_RS06915 (BRW83_1373) | ssb | 1445461..1445910 (+) | 450 | WP_086131796.1 | single-stranded DNA-binding protein | Machinery gene |
| BRW83_RS06920 (BRW83_1374) | - | 1445936..1446115 (+) | 180 | WP_086131797.1 | hypothetical protein | - |
| BRW83_RS12065 | - | 1446112..1446243 (+) | 132 | WP_257789307.1 | hypothetical protein | - |
| BRW83_RS06925 (BRW83_1375) | - | 1446322..1446609 (+) | 288 | WP_086131798.1 | helix-turn-helix transcriptional regulator | - |
| BRW83_RS06930 (BRW83_1376) | - | 1447117..1447782 (+) | 666 | WP_231284476.1 | LexA family protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16950.86 Da Isoelectric Point: 7.0184
>NTDB_id=210209 BRW83_RS06915 WP_086131796.1 1445461..1445910(+) (ssb) [Oxalobacter formigenes strain HC-1]
MASINKVIIVGNLGRDPENRYLPSGEQVTSITVATTDRWRDKTSGEQKEQTEWHRISFFGKLAEIAGQYLKKGSQVYIEG
RLRTRKYTDKEGVDRYATEIIADTMQMLGSRQDSQSTGRNEYAEQTGRSQPTQRKTPPTADMLDDDIPF
MASINKVIIVGNLGRDPENRYLPSGEQVTSITVATTDRWRDKTSGEQKEQTEWHRISFFGKLAEIAGQYLKKGSQVYIEG
RLRTRKYTDKEGVDRYATEIIADTMQMLGSRQDSQSTGRNEYAEQTGRSQPTQRKTPPTADMLDDDIPF
Nucleotide
Download Length: 450 bp
>NTDB_id=210209 BRW83_RS06915 WP_086131796.1 1445461..1445910(+) (ssb) [Oxalobacter formigenes strain HC-1]
ATGGCATCAATCAACAAAGTAATCATCGTCGGCAATCTTGGCCGGGATCCTGAAAATCGCTATTTGCCAAGTGGCGAACA
GGTCACCAGTATCACTGTCGCAACGACTGATCGCTGGCGTGACAAAACATCGGGTGAACAGAAAGAACAGACCGAATGGC
ACCGTATTTCATTCTTCGGCAAACTGGCAGAGATTGCCGGTCAGTATCTGAAAAAGGGTTCACAGGTCTATATCGAAGGC
CGTCTGAGAACGCGTAAATATACCGACAAGGAAGGTGTTGACCGTTACGCGACCGAAATCATCGCCGACACCATGCAAAT
GCTCGGCAGCCGTCAGGATTCACAAAGCACGGGGCGGAATGAGTACGCCGAACAGACAGGACGGTCACAGCCTACGCAGC
GCAAGACCCCGCCAACTGCCGACATGTTGGACGATGATATTCCCTTCTGA
ATGGCATCAATCAACAAAGTAATCATCGTCGGCAATCTTGGCCGGGATCCTGAAAATCGCTATTTGCCAAGTGGCGAACA
GGTCACCAGTATCACTGTCGCAACGACTGATCGCTGGCGTGACAAAACATCGGGTGAACAGAAAGAACAGACCGAATGGC
ACCGTATTTCATTCTTCGGCAAACTGGCAGAGATTGCCGGTCAGTATCTGAAAAAGGGTTCACAGGTCTATATCGAAGGC
CGTCTGAGAACGCGTAAATATACCGACAAGGAAGGTGTTGACCGTTACGCGACCGAAATCATCGCCGACACCATGCAAAT
GCTCGGCAGCCGTCAGGATTCACAAAGCACGGGGCGGAATGAGTACGCCGAACAGACAGGACGGTCACAGCCTACGCAGC
GCAAGACCCCGCCAACTGCCGACATGTTGGACGATGATATTCCCTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
50 |
100 |
0.597 |
| ssb | Glaesserella parasuis strain SC1401 |
46.667 |
100 |
0.564 |
| ssb | Neisseria meningitidis MC58 |
44.318 |
100 |
0.523 |
| ssb | Neisseria gonorrhoeae MS11 |
44.318 |
100 |
0.523 |