Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   TE101_RS00895 Genome accession   NZ_CP018321
Coordinates   199233..199817 (+) Length   194 a.a.
NCBI ID   WP_101563267.1    Uniprot ID   -
Organism   Alteromonas macleodii strain Te101     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 123923..200085 199233..199817 within 0


Gene organization within MGE regions


Location: 123923..200085
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  TE101_RS00570 (TE101_00575) - 124566..125747 (+) 1182 WP_101563246.1 NAD(P)/FAD-dependent oxidoreductase -
  TE101_RS00575 (TE101_00580) - 125807..126478 (-) 672 WP_039226909.1 OmpW family protein -
  TE101_RS00580 (TE101_00585) - 126616..127083 (-) 468 WP_014947817.1 hypothetical protein -
  TE101_RS00585 (TE101_00590) - 127308..127616 (+) 309 WP_014947818.1 hypothetical protein -
  TE101_RS00590 (TE101_00595) - 127767..128954 (+) 1188 WP_101566505.1 diguanylate phosphodiesterase -
  TE101_RS00595 (TE101_00600) - 129163..130710 (+) 1548 WP_232379105.1 diguanylate cyclase -
  TE101_RS00600 (TE101_00605) - 130752..131636 (-) 885 WP_039226907.1 ArgP/LysG family DNA-binding transcriptional regulator -
  TE101_RS00605 (TE101_00610) - 131814..132416 (+) 603 WP_014975330.1 LysE/ArgO family amino acid transporter -
  TE101_RS00610 (TE101_00615) - 132532..132849 (+) 318 WP_014947823.1 multidrug efflux SMR transporter -
  TE101_RS00615 (TE101_00620) - 132924..133640 (-) 717 WP_014977950.1 DUF1499 domain-containing protein -
  TE101_RS00620 (TE101_00625) - 133836..134528 (+) 693 WP_101563248.1 DNA-J related domain-containing protein -
  TE101_RS00625 (TE101_00630) - 134845..135990 (+) 1146 WP_014947826.1 efflux RND transporter periplasmic adaptor subunit -
  TE101_RS00630 (TE101_00635) - 136012..139110 (+) 3099 WP_014947827.1 efflux RND transporter permease subunit -
  TE101_RS00635 (TE101_00640) - 139167..139664 (+) 498 WP_014947828.1 alpha/beta hydrolase -
  TE101_RS00640 (TE101_00645) - 139778..141619 (+) 1842 WP_014947829.1 bifunctional acetyl-CoA hydrolase/transferase family protein/GNAT family N-acetyltransferase -
  TE101_RS00645 (TE101_00650) - 141616..142596 (+) 981 WP_014947830.1 histone deacetylase family protein -
  TE101_RS00650 (TE101_00655) - 142692..143432 (-) 741 WP_101563249.1 MauE/DoxX family redox-associated membrane protein -
  TE101_RS00655 (TE101_00660) - 143555..144073 (-) 519 WP_101563250.1 DUF6436 domain-containing protein -
  TE101_RS00660 (TE101_00665) - 144110..145591 (-) 1482 WP_101563251.1 methyl-accepting chemotaxis protein -
  TE101_RS00665 (TE101_00670) - 145765..146637 (+) 873 WP_101563252.1 RimK family alpha-L-glutamate ligase -
  TE101_RS00670 (TE101_00675) - 146719..148161 (-) 1443 WP_101563253.1 DUF3300 domain-containing protein -
  TE101_RS00675 (TE101_00680) ribA 148297..148911 (-) 615 WP_014947836.1 GTP cyclohydrolase II -
  TE101_RS00680 (TE101_00685) - 149044..151890 (-) 2847 WP_014947837.1 EAL domain-containing protein -
  TE101_RS00685 (TE101_00690) - 151979..152296 (-) 318 WP_014975341.1 hypothetical protein -
  TE101_RS00690 (TE101_00695) - 152402..153070 (+) 669 WP_014975342.1 glutathione S-transferase -
  TE101_RS00695 (TE101_00700) recQ 153154..154995 (-) 1842 WP_039226893.1 DNA helicase RecQ -
  TE101_RS00700 (TE101_00705) - 155209..155721 (+) 513 WP_014975344.1 thioesterase family protein -
  TE101_RS00705 (TE101_00710) - 155808..157145 (+) 1338 WP_014977961.1 magnesium transporter -
  TE101_RS00710 (TE101_00715) rarD 157375..158289 (+) 915 WP_101563254.1 EamA family transporter RarD -
  TE101_RS00715 (TE101_00720) - 158356..159633 (-) 1278 WP_014977963.1 diguanylate cyclase -
  TE101_RS00720 (TE101_00725) uvrD 159676..161847 (-) 2172 WP_014977964.1 DNA helicase II -
  TE101_RS00725 (TE101_00730) cysE 162311..163117 (+) 807 WP_014947845.1 serine O-acetyltransferase -
  TE101_RS00730 (TE101_00735) - 163215..164723 (-) 1509 WP_101563255.1 diguanylate cyclase -
  TE101_RS00735 (TE101_00740) - 164893..165633 (-) 741 WP_101563256.1 HAD-IA family hydrolase -
  TE101_RS00740 (TE101_00745) xerC 165654..166574 (-) 921 WP_014947848.1 tyrosine recombinase XerC -
  TE101_RS00745 (TE101_00750) - 166580..167275 (-) 696 WP_014947849.1 DUF484 family protein -
  TE101_RS00750 (TE101_00755) dapF 167272..168102 (-) 831 WP_014947850.1 diaminopimelate epimerase -
  TE101_RS00755 (TE101_00760) lysA 168138..169388 (-) 1251 WP_101563257.1 diaminopimelate decarboxylase -
  TE101_RS00760 (TE101_00765) lptM 169388..169624 (-) 237 WP_069943528.1 LPS translocon maturation chaperone LptM -
  TE101_RS00765 (TE101_00770) - 169637..170704 (-) 1068 WP_014947853.1 MJ1255/VC2487 family glycosyltransferase -
  TE101_RS00770 (TE101_00775) - 170706..171224 (-) 519 WP_014947854.1 phosphatase PAP2 family protein -
  TE101_RS00775 (TE101_00780) rraA 171577..172062 (+) 486 WP_014947855.1 ribonuclease E activity regulator RraA -
  TE101_RS00780 (TE101_00785) - 172151..173392 (+) 1242 WP_101563258.1 ABC transporter substrate-binding protein -
  TE101_RS00785 (TE101_00790) - 173424..174233 (-) 810 WP_039226872.1 S1/P1 nuclease -
  TE101_RS00790 (TE101_00795) - 174236..174868 (-) 633 WP_014975357.1 flavin prenyltransferase UbiX -
  TE101_RS00795 (TE101_00800) mpl 174940..176298 (-) 1359 WP_101563259.1 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase -
  TE101_RS00800 (TE101_00805) - 176610..177587 (+) 978 WP_014947860.1 class 1 fructose-bisphosphatase -
  TE101_RS00805 (TE101_00810) ppa 177718..178248 (+) 531 WP_014947861.1 inorganic diphosphatase -
  TE101_RS00810 (TE101_00815) - 178390..178875 (+) 486 WP_014947862.1 DUF3299 domain-containing protein -
  TE101_RS00815 (TE101_00820) - 178903..179850 (+) 948 WP_101563260.1 dihydrodipicolinate synthase family protein -
  TE101_RS00820 (TE101_00825) - 179847..180545 (-) 699 WP_014975360.1 2OG-Fe(II) oxygenase -
  TE101_RS00825 (TE101_00830) - 180568..180987 (-) 420 WP_101563261.1 thioesterase family protein -
  TE101_RS00830 (TE101_00835) - 181201..181677 (+) 477 WP_014947866.1 MarR family winged helix-turn-helix transcriptional regulator -
  TE101_RS00835 (TE101_00840) - 181689..182924 (+) 1236 WP_101563262.1 S41 family peptidase -
  TE101_RS00840 (TE101_00845) - 183001..184503 (+) 1503 WP_039226858.1 Hsp70 family protein -
  TE101_RS21335 - 184581..184748 (-) 168 WP_012516741.1 hypothetical protein -
  TE101_RS00845 (TE101_00850) uvrA 184952..187783 (-) 2832 WP_049587075.1 excinuclease ABC subunit UvrA -
  TE101_RS00850 (TE101_00855) - 188152..189489 (+) 1338 WP_101563263.1 MFS transporter -
  TE101_RS00855 (TE101_00860) - 189555..190139 (+) 585 WP_014977981.1 HAD family phosphatase -
  TE101_RS00860 (TE101_00865) - 190214..190828 (-) 615 WP_230633747.1 hypothetical protein -
  TE101_RS00865 (TE101_00870) - 191061..191924 (+) 864 WP_039226852.1 alpha/beta hydrolase -
  TE101_RS00870 (TE101_00875) - 192336..193337 (-) 1002 WP_014947876.1 LacI family DNA-binding transcriptional regulator -
  TE101_RS00875 (TE101_00880) - 193666..194685 (+) 1020 WP_101563264.1 aldose epimerase family protein -
  TE101_RS00880 (TE101_00885) - 194858..195913 (+) 1056 WP_101563265.1 UDP-glucose--hexose-1-phosphate uridylyltransferase -
  TE101_RS00885 (TE101_00890) galK 195906..197045 (+) 1140 WP_014947879.1 galactokinase -
  TE101_RS00890 (TE101_00895) - 197403..198965 (+) 1563 WP_101563266.1 sodium/sugar symporter -
  TE101_RS00895 (TE101_00900) ssb 199233..199817 (+) 585 WP_101563267.1 single-stranded DNA-binding protein Machinery gene

Sequence


Protein


Download         Length: 194 a.a.        Molecular weight: 21165.06 Da        Isoelectric Point: 5.2494

>NTDB_id=208049 TE101_RS00895 WP_101563267.1 199233..199817(+) (ssb) [Alteromonas macleodii strain Te101]
MATKGVNKVILVGNLGNDPEVRYMPNGNAVANLSLATSESWKDQQGQVQERTEWHRLTMYRRLAEIAGEYLKKGSQIYVE
GKLQTRKWQDQQGQDRYTTEIIVDQMQMLGGRGGEGGGGNGGYQRPQNNQGGYNQAPAQGGYNQAPQQGGGQQGGYNSNQ
GGGYNQAPHGGNQGQPKNPPMAEPDFDFDDDIPF

Nucleotide


Download         Length: 585 bp        

>NTDB_id=208049 TE101_RS00895 WP_101563267.1 199233..199817(+) (ssb) [Alteromonas macleodii strain Te101]
ATGGCAACGAAAGGCGTTAATAAGGTTATTCTTGTTGGAAACCTTGGCAATGATCCTGAAGTTAGATACATGCCTAACGG
AAACGCCGTTGCGAACTTAAGCCTAGCAACTAGCGAAAGCTGGAAAGACCAACAGGGTCAGGTTCAAGAGCGCACTGAGT
GGCACCGCCTTACAATGTACCGTCGCTTAGCAGAAATTGCCGGAGAGTACCTGAAAAAGGGCTCGCAAATTTATGTTGAA
GGTAAATTGCAGACGCGTAAGTGGCAAGATCAACAAGGCCAAGATAGATACACCACTGAAATTATCGTAGACCAAATGCA
AATGCTTGGTGGTCGCGGTGGTGAAGGTGGCGGCGGTAACGGTGGTTACCAACGTCCTCAAAACAACCAAGGTGGTTACA
ATCAAGCTCCAGCGCAGGGCGGCTATAACCAAGCGCCACAGCAAGGTGGTGGTCAGCAGGGCGGCTACAACTCAAACCAA
GGTGGTGGCTACAATCAAGCGCCTCATGGTGGCAATCAAGGTCAGCCAAAGAACCCACCAATGGCTGAGCCAGATTTTGA
CTTCGACGATGACATTCCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

56.566

100

0.577

  ssb Vibrio cholerae strain A1552

54.5

100

0.562

  ssb Neisseria meningitidis MC58

46.875

98.969

0.464

  ssb Neisseria gonorrhoeae MS11

46.875

98.969

0.464


Multiple sequence alignment