Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   L_RS11100 Genome accession   NC_002662
Coordinates   2185338..2185622 (-) Length   94 a.a.
NCBI ID   WP_010906314.1    Uniprot ID   A0AAC9R304
Organism   Lactococcus lactis subsp. lactis Il1403     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2180338..2190622
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L_RS11070 (L164222) - 2180778..2181155 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  L_RS11075 (L164789) - 2181360..2182226 (+) 867 WP_010906309.1 RluA family pseudouridine synthase -
  L_RS11080 (L165709) - 2182265..2183074 (-) 810 WP_010906310.1 metal ABC transporter permease -
  L_RS11085 (L166512) - 2183067..2183804 (-) 738 WP_010906311.1 metal ABC transporter ATP-binding protein -
  L_RS11090 (L167426) - 2183981..2184823 (-) 843 WP_010906312.1 metal ABC transporter substrate-binding protein -
  L_RS11095 (L168265) - 2184820..2185257 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  L_RS11100 (L168783) comGG 2185338..2185622 (-) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  L_RS11105 (L169106) comGF 2185661..2186107 (-) 447 WP_164752712.1 competence type IV pilus minor pilin ComGF Machinery gene
  L_RS11110 (L169515) comGE 2186070..2186366 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  L_RS11115 (L169783) comGD 2186338..2186754 (-) 417 WP_021216554.1 competence type IV pilus minor pilin ComGD Machinery gene
  L_RS11120 (L0315) comGC 2186729..2187112 (-) 384 WP_010906318.1 competence type IV pilus major pilin ComGC Machinery gene
  L_RS11125 (L0314) comGB 2187126..2188199 (-) 1074 WP_010906319.1 competence type IV pilus assembly protein ComGB Machinery gene
  L_RS11130 (L0313) comGA 2188093..2189031 (-) 939 WP_010906320.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=20773 L_RS11100 WP_010906314.1 2185338..2185622(-) (comGG) [Lactococcus lactis subsp. lactis Il1403]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=20773 L_RS11100 WP_010906314.1 2185338..2185622(-) (comGG) [Lactococcus lactis subsp. lactis Il1403]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585

Multiple sequence alignment