Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   BKJ37_RS20170 Genome accession   NZ_CP018143
Coordinates   2975379..2975480 (-) Length   33 a.a.
NCBI ID   WP_168713084.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain HRAB-85     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2973903..3016769 2975379..2975480 within 0


Gene organization within MGE regions


Location: 2973903..3016769
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BKJ37_RS14455 (BKJ37_14230) - 2973903..2974949 (-) 1047 WP_000027064.1 nucleoid-associated protein -
  BKJ37_RS20170 ssb 2975379..2975480 (-) 102 WP_168713084.1 single-stranded DNA-binding protein Machinery gene
  BKJ37_RS14465 (BKJ37_14235) - 2975462..2976904 (-) 1443 WP_000003535.1 hypothetical protein -
  BKJ37_RS20790 (BKJ37_14240) - 2977127..2977243 (-) 117 WP_001992235.1 single-stranded DNA-binding protein -
  BKJ37_RS14475 (BKJ37_14245) - 2977577..2980042 (-) 2466 WP_001022397.1 DUF927 domain-containing protein -
  BKJ37_RS14480 (BKJ37_14250) - 2980055..2980333 (-) 279 WP_001064707.1 hypothetical protein -
  BKJ37_RS14485 (BKJ37_14255) - 2980455..2980760 (-) 306 WP_000787149.1 hypothetical protein -
  BKJ37_RS14490 (BKJ37_14260) - 2980770..2981138 (-) 369 WP_001046481.1 hypothetical protein -
  BKJ37_RS14495 (BKJ37_14265) - 2981131..2981685 (-) 555 WP_001988245.1 Bro-N domain-containing protein -
  BKJ37_RS14500 (BKJ37_14270) - 2981682..2981891 (-) 210 WP_001016479.1 helix-turn-helix domain-containing protein -
  BKJ37_RS14505 (BKJ37_14275) - 2981894..2982109 (-) 216 WP_000153154.1 hypothetical protein -
  BKJ37_RS14510 (BKJ37_14280) - 2982319..2983086 (-) 768 WP_000578618.1 hypothetical protein -
  BKJ37_RS14515 (BKJ37_14285) - 2983234..2984463 (-) 1230 WP_001991065.1 tyrosine-type recombinase/integrase -
  BKJ37_RS14520 (BKJ37_14290) - 2984839..2985504 (-) 666 WP_001050367.1 hypothetical protein -
  BKJ37_RS14525 (BKJ37_14295) - 2985653..2986288 (+) 636 WP_000332614.1 SOS response-associated peptidase -
  BKJ37_RS14530 (BKJ37_14300) - 2986430..2986930 (+) 501 WP_000022554.1 LexA family protein -
  BKJ37_RS14535 (BKJ37_14305) - 2986927..2988225 (+) 1299 WP_001215499.1 DNA polymerase V subunit UmuC -
  BKJ37_RS14540 (BKJ37_14310) - 2988379..2989077 (+) 699 WP_001072150.1 hypothetical protein -
  BKJ37_RS14545 - 2989200..2989403 (-) 204 Protein_2827 IS5/IS1182 family transposase -
  BKJ37_RS14550 (BKJ37_14315) - 2989404..2989820 (+) 417 Protein_2828 hypothetical protein -
  BKJ37_RS14555 (BKJ37_14320) - 2989946..2990716 (-) 771 WP_000766533.1 TIGR02594 family protein -
  BKJ37_RS14560 (BKJ37_14325) - 2990713..2991000 (-) 288 WP_001279704.1 holin -
  BKJ37_RS14565 (BKJ37_14330) - 2991122..2991340 (-) 219 WP_000894311.1 hypothetical protein -
  BKJ37_RS14570 (BKJ37_14335) - 2991333..2992031 (-) 699 WP_000627457.1 hypothetical protein -
  BKJ37_RS14575 (BKJ37_14340) - 2992031..2992825 (-) 795 WP_000030339.1 hypothetical protein -
  BKJ37_RS14580 (BKJ37_14345) - 2992913..2993161 (-) 249 WP_000594623.1 helix-turn-helix transcriptional regulator -
  BKJ37_RS14585 (BKJ37_14350) - 2993363..2994262 (+) 900 WP_000067916.1 phage antirepressor N-terminal domain-containing protein -
  BKJ37_RS14590 (BKJ37_14355) - 2994421..2995134 (-) 714 WP_000373973.1 hypothetical protein -
  BKJ37_RS14595 (BKJ37_14360) - 2995350..2996429 (-) 1080 WP_000067934.1 helix-turn-helix domain-containing protein -
  BKJ37_RS14600 (BKJ37_14365) - 2996426..2997055 (-) 630 WP_000951724.1 hypothetical protein -
  BKJ37_RS14605 (BKJ37_14370) - 2997206..2998657 (-) 1452 WP_000209670.1 hypothetical protein -
  BKJ37_RS14610 (BKJ37_14375) - 2998657..3000609 (-) 1953 WP_002096209.1 hypothetical protein -
  BKJ37_RS14615 (BKJ37_14380) - 3000683..3001336 (-) 654 WP_000863709.1 hypothetical protein -
  BKJ37_RS14620 (BKJ37_14385) - 3001336..3002871 (-) 1536 WP_000098517.1 hypothetical protein -
  BKJ37_RS14625 (BKJ37_14390) - 3003030..3003224 (+) 195 WP_000852568.1 hypothetical protein -
  BKJ37_RS14630 (BKJ37_14395) - 3003252..3004022 (-) 771 WP_000852825.1 hypothetical protein -
  BKJ37_RS14635 (BKJ37_14400) - 3004022..3004309 (-) 288 WP_002017462.1 hypothetical protein -
  BKJ37_RS14640 (BKJ37_14405) - 3004421..3014773 (-) 10353 WP_001013740.1 interleukin-like EMT inducer domain-containing protein -
  BKJ37_RS14645 (BKJ37_14410) - 3014783..3015676 (-) 894 WP_001167468.1 hypothetical protein -
  BKJ37_RS14650 (BKJ37_14415) - 3015676..3016125 (-) 450 WP_001240941.1 hypothetical protein -
  BKJ37_RS14655 (BKJ37_14420) - 3016125..3016769 (-) 645 WP_001187723.1 hypothetical protein -

Sequence

Protein


Download         Length: 33 a.a.        Molecular weight: 3621.22 Da        Isoelectric Point: 9.7265

>NTDB_id=206350 BKJ37_RS20170 WP_168713084.1 2975379..2975480(-) (ssb) [Acinetobacter baumannii strain HRAB-85]
MVSSQLAEISSKYLKKGGKVYVEGSLCTGKWKD

Nucleotide


Download         Length: 102 bp        

>NTDB_id=206350 BKJ37_RS20170 WP_168713084.1 2975379..2975480(-) (ssb) [Acinetobacter baumannii strain HRAB-85]
TTGGTTAGTTCCCAATTAGCCGAGATTTCCAGTAAGTACCTTAAGAAAGGTGGCAAGGTTTATGTTGAGGGTTCATTGTG
TACTGGGAAGTGGAAAGACTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-33)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.963

81.818

0.515
  ssb Vibrio cholerae strain A1552

55.172

87.879

0.485
  ssb Neisseria gonorrhoeae MS11

53.571

84.848

0.455
  ssb Neisseria meningitidis MC58

53.571

84.848

0.455

Multiple sequence alignment