Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BMJ37_RS12215 Genome accession   NZ_CP018133
Coordinates   2514222..2514599 (-) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain ATR2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2509222..2519599
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BMJ37_RS12175 (BMJ37_11770) - 2509719..2510513 (+) 795 WP_014418368.1 YqhG family protein -
  BMJ37_RS12180 (BMJ37_11775) sinI 2510690..2510863 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  BMJ37_RS12185 (BMJ37_11780) sinR 2510897..2511232 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BMJ37_RS12190 (BMJ37_11785) tasA 2511280..2512065 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BMJ37_RS12195 (BMJ37_11790) sipW 2512130..2512714 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BMJ37_RS12200 (BMJ37_11795) tapA 2512686..2513357 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BMJ37_RS12205 (BMJ37_11800) - 2513616..2513945 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BMJ37_RS12210 (BMJ37_11805) - 2513986..2514165 (-) 180 WP_003153093.1 YqzE family protein -
  BMJ37_RS12215 (BMJ37_11810) comGG 2514222..2514599 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  BMJ37_RS12220 (BMJ37_11815) comGF 2514600..2514995 (-) 396 WP_050569584.1 competence type IV pilus minor pilin ComGF -
  BMJ37_RS12225 (BMJ37_11820) comGE 2515009..2515323 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  BMJ37_RS12230 (BMJ37_11825) comGD 2515307..2515744 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BMJ37_RS12235 (BMJ37_11830) comGC 2515734..2516042 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  BMJ37_RS12240 (BMJ37_11835) comGB 2516047..2517084 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  BMJ37_RS12245 (BMJ37_11840) comGA 2517071..2518141 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  BMJ37_RS12250 (BMJ37_11845) - 2518334..2519284 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=205985 BMJ37_RS12215 WP_017418138.1 2514222..2514599(-) (comGG) [Bacillus velezensis strain ATR2]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=205985 BMJ37_RS12215 WP_017418138.1 2514222..2514599(-) (comGG) [Bacillus velezensis strain ATR2]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment