Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BMJ37_RS12180 | Genome accession | NZ_CP018133 |
| Coordinates | 2510690..2510863 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain ATR2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2505690..2515863
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BMJ37_RS12165 (BMJ37_11760) | gcvT | 2506503..2507603 (-) | 1101 | WP_029973877.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BMJ37_RS12170 (BMJ37_11765) | - | 2508027..2509697 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| BMJ37_RS12175 (BMJ37_11770) | - | 2509719..2510513 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| BMJ37_RS12180 (BMJ37_11775) | sinI | 2510690..2510863 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| BMJ37_RS12185 (BMJ37_11780) | sinR | 2510897..2511232 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BMJ37_RS12190 (BMJ37_11785) | tasA | 2511280..2512065 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BMJ37_RS12195 (BMJ37_11790) | sipW | 2512130..2512714 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| BMJ37_RS12200 (BMJ37_11795) | tapA | 2512686..2513357 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BMJ37_RS12205 (BMJ37_11800) | - | 2513616..2513945 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BMJ37_RS12210 (BMJ37_11805) | - | 2513986..2514165 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BMJ37_RS12215 (BMJ37_11810) | comGG | 2514222..2514599 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BMJ37_RS12220 (BMJ37_11815) | comGF | 2514600..2514995 (-) | 396 | WP_050569584.1 | competence type IV pilus minor pilin ComGF | - |
| BMJ37_RS12225 (BMJ37_11820) | comGE | 2515009..2515323 (-) | 315 | WP_029973875.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BMJ37_RS12230 (BMJ37_11825) | comGD | 2515307..2515744 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=205983 BMJ37_RS12180 WP_014418369.1 2510690..2510863(+) (sinI) [Bacillus velezensis strain ATR2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=205983 BMJ37_RS12180 WP_014418369.1 2510690..2510863(+) (sinI) [Bacillus velezensis strain ATR2]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |