Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   JHP_RS00200 Genome accession   NC_000921
Coordinates   37757..37870 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori J99     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32757..42870
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JHP_RS00175 (jhp0029) - 32798..35026 (+) 2229 WP_000357196.1 AAA family ATPase -
  JHP_RS00180 (jhp0030) panD 35016..35369 (+) 354 WP_000142257.1 aspartate 1-decarboxylase -
  JHP_RS00185 (jhp0031) - 35372..35674 (+) 303 WP_000347931.1 YbaB/EbfC family nucleoid-associated protein -
  JHP_RS00190 (jhp0032) - 35674..36678 (+) 1005 WP_000468465.1 PDZ domain-containing protein -
  JHP_RS00195 (jhp0033) comB6 36686..37741 (+) 1056 WP_000679725.1 P-type conjugative transfer protein TrbL Machinery gene
  JHP_RS00200 comB7 37757..37870 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  JHP_RS00205 (jhp0034) comB8 37867..38610 (+) 744 WP_000660577.1 type IV secretion system protein Machinery gene
  JHP_RS00210 (jhp0035) comB9 38610..39596 (+) 987 WP_001878684.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  JHP_RS00215 (jhp0036) comB10 39589..40719 (+) 1131 WP_001045766.1 DNA type IV secretion system protein ComB10 Machinery gene
  JHP_RS00220 (jhp0037) - 40789..42201 (+) 1413 WP_000694964.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=20492 JHP_RS00200 WP_001217877.1 37757..37870(+) (comB7) [Helicobacter pylori J99]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=20492 JHP_RS00200 WP_001217877.1 37757..37870(+) (comB7) [Helicobacter pylori J99]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
TACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment