Detailed information    

insolico Bioinformatically predicted

Overview


Name   braR   Type   Regulator
Locus tag   SSU05_0885 Genome accession   CP000407
Coordinates   858886..859110 (-) Length   74 a.a.
NCBI ID   ABP89851.1    Uniprot ID   -
Organism   Streptococcus suis 05ZYH33     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Genomic Context


Location: 853886..864110
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SSU05_0880 - 853894..854415 (+) 522 ABP89846.1 hypothetical protein -
  SSU05_0881 xerS 854771..855844 (+) 1074 ABP89847.1 Integrase Machinery gene
  SSU05_0882 - 855914..857422 (-) 1509 ABP89848.1 Phosphomannomutase -
  SSU05_0883 - 857475..858440 (-) 966 ABP89849.1 Signal transduction histidine kinase -
  SSU05_0884 braR 858437..858889 (-) 453 ABP89850.1 Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain Regulator
  SSU05_0885 braR 858886..859110 (-) 225 ABP89851.1 Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain Regulator
  SSU05_0886 - 859140..859397 (-) 258 ABP89852.1 Cytotoxic translational repressor of toxin-antitoxin stability system -
  SSU05_0887 - 859381..859617 (-) 237 ABP89853.1 hypothetical protein -
  SSU05_0888 - 859754..860854 (-) 1101 ABP89854.1 ABC-type antimicrobial peptide transport system, permease component -
  SSU05_0889 - 861109..861285 (-) 177 ABP89855.1 ABC-type antimicrobial peptide transport system, permease component -
  SSU05_0890 - 861285..861698 (-) 414 ABP89856.1 ABC-type antimicrobial peptide transport system, permease component -
  SSU05_0891 - 861699..862451 (-) 753 ABP89857.1 ABC-type antimicrobial peptide transport system, ATPase component -
  SSU05_0892 - 862587..863321 (-) 735 ABP89858.1 putative bacteroiocin operon protein -
  SSU05_0893 - 863323..864069 (-) 747 ABP89859.1 hypothetical protein -

Sequence


Protein


Download         Length: 74 a.a.        Molecular weight: 8856.33 Da        Isoelectric Point: 7.0079

>NTDB_id=20160 SSU05_0885 ABP89851.1 858886..859110(-) (braR) [Streptococcus suis 05ZYH33]
MKKMKKEKIYIVEDDEMIVQLLKQHLGKSYQVESVQNFRAVSQEVAEIKPDLVLMDINLPYYNGFYWTTEIRKT

Nucleotide


Download         Length: 225 bp        

>NTDB_id=20160 SSU05_0885 ABP89851.1 858886..859110(-) (braR) [Streptococcus suis 05ZYH33]
ATGAAGAAGATGAAAAAAGAGAAGATTTATATTGTTGAAGATGATGAGATGATTGTCCAACTCTTGAAGCAGCATTTGGG
AAAATCTTATCAGGTAGAAAGTGTGCAGAATTTCCGAGCTGTCAGTCAGGAAGTTGCGGAAATCAAACCAGACTTAGTGC
TGATGGACATTAACTTGCCCTATTACAACGGTTTTTATTGGACGACAGAAATCCGTAAAACATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  braR Staphylococcus aureus N315

48.529

91.892

0.446


Multiple sequence alignment