Detailed information
Overview
| Name | braR | Type | Regulator |
| Locus tag | SSU05_0885 | Genome accession | CP000407 |
| Coordinates | 858886..859110 (-) | Length | 74 a.a. |
| NCBI ID | ABP89851.1 | Uniprot ID | - |
| Organism | Streptococcus suis 05ZYH33 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Genomic Context
Location: 853886..864110
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSU05_0880 | - | 853894..854415 (+) | 522 | ABP89846.1 | hypothetical protein | - |
| SSU05_0881 | xerS | 854771..855844 (+) | 1074 | ABP89847.1 | Integrase | Machinery gene |
| SSU05_0882 | - | 855914..857422 (-) | 1509 | ABP89848.1 | Phosphomannomutase | - |
| SSU05_0883 | - | 857475..858440 (-) | 966 | ABP89849.1 | Signal transduction histidine kinase | - |
| SSU05_0884 | braR | 858437..858889 (-) | 453 | ABP89850.1 | Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain | Regulator |
| SSU05_0885 | braR | 858886..859110 (-) | 225 | ABP89851.1 | Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain | Regulator |
| SSU05_0886 | - | 859140..859397 (-) | 258 | ABP89852.1 | Cytotoxic translational repressor of toxin-antitoxin stability system | - |
| SSU05_0887 | - | 859381..859617 (-) | 237 | ABP89853.1 | hypothetical protein | - |
| SSU05_0888 | - | 859754..860854 (-) | 1101 | ABP89854.1 | ABC-type antimicrobial peptide transport system, permease component | - |
| SSU05_0889 | - | 861109..861285 (-) | 177 | ABP89855.1 | ABC-type antimicrobial peptide transport system, permease component | - |
| SSU05_0890 | - | 861285..861698 (-) | 414 | ABP89856.1 | ABC-type antimicrobial peptide transport system, permease component | - |
| SSU05_0891 | - | 861699..862451 (-) | 753 | ABP89857.1 | ABC-type antimicrobial peptide transport system, ATPase component | - |
| SSU05_0892 | - | 862587..863321 (-) | 735 | ABP89858.1 | putative bacteroiocin operon protein | - |
| SSU05_0893 | - | 863323..864069 (-) | 747 | ABP89859.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 74 a.a. Molecular weight: 8856.33 Da Isoelectric Point: 7.0079
>NTDB_id=20160 SSU05_0885 ABP89851.1 858886..859110(-) (braR) [Streptococcus suis 05ZYH33]
MKKMKKEKIYIVEDDEMIVQLLKQHLGKSYQVESVQNFRAVSQEVAEIKPDLVLMDINLPYYNGFYWTTEIRKT
MKKMKKEKIYIVEDDEMIVQLLKQHLGKSYQVESVQNFRAVSQEVAEIKPDLVLMDINLPYYNGFYWTTEIRKT
Nucleotide
Download Length: 225 bp
>NTDB_id=20160 SSU05_0885 ABP89851.1 858886..859110(-) (braR) [Streptococcus suis 05ZYH33]
ATGAAGAAGATGAAAAAAGAGAAGATTTATATTGTTGAAGATGATGAGATGATTGTCCAACTCTTGAAGCAGCATTTGGG
AAAATCTTATCAGGTAGAAAGTGTGCAGAATTTCCGAGCTGTCAGTCAGGAAGTTGCGGAAATCAAACCAGACTTAGTGC
TGATGGACATTAACTTGCCCTATTACAACGGTTTTTATTGGACGACAGAAATCCGTAAAACATGA
ATGAAGAAGATGAAAAAAGAGAAGATTTATATTGTTGAAGATGATGAGATGATTGTCCAACTCTTGAAGCAGCATTTGGG
AAAATCTTATCAGGTAGAAAGTGTGCAGAATTTCCGAGCTGTCAGTCAGGAAGTTGCGGAAATCAAACCAGACTTAGTGC
TGATGGACATTAACTTGCCCTATTACAACGGTTTTTATTGGACGACAGAAATCCGTAAAACATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| braR | Staphylococcus aureus N315 |
48.529 |
91.892 |
0.446 |