Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AB478_RS05565 Genome accession   NZ_CP017679
Coordinates   1095887..1096357 (+) Length   156 a.a.
NCBI ID   WP_099143902.1    Uniprot ID   -
Organism   Staphylococcus aureus strain CFSAN007883     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1085951..1127125 1095887..1096357 within 0


Gene organization within MGE regions


Location: 1085951..1127125
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB478_RS05490 (AB478_05315) - 1085951..1087336 (-) 1386 WP_000861313.1 recombinase family protein -
  AB478_RS05495 (AB478_05320) - 1087543..1088223 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  AB478_RS05500 (AB478_05325) - 1088363..1088530 (-) 168 WP_000705247.1 hypothetical protein -
  AB478_RS05505 (AB478_05330) - 1088732..1089361 (-) 630 WP_029549401.1 LexA family protein -
  AB478_RS05510 (AB478_05335) - 1089515..1089742 (+) 228 WP_015978369.1 helix-turn-helix transcriptional regulator -
  AB478_RS05515 (AB478_05340) - 1089765..1090541 (+) 777 WP_029549402.1 Rha family transcriptional regulator -
  AB478_RS05520 (AB478_05345) - 1090570..1090709 (+) 140 Protein_1034 hypothetical protein -
  AB478_RS05525 (AB478_05350) - 1090702..1090911 (-) 210 WP_000772137.1 hypothetical protein -
  AB478_RS05530 (AB478_05355) - 1091118..1091348 (-) 231 WP_000395457.1 hypothetical protein -
  AB478_RS14155 - 1091407..1091544 (+) 138 WP_001568566.1 hypothetical protein -
  AB478_RS05535 (AB478_05360) - 1091528..1091689 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  AB478_RS05540 (AB478_05365) - 1091782..1092042 (+) 261 WP_029549408.1 DUF1108 family protein -
  AB478_RS05545 (AB478_05370) - 1092051..1092314 (+) 264 WP_001205732.1 hypothetical protein -
  AB478_RS05550 (AB478_05375) - 1092323..1094266 (+) 1944 WP_099143901.1 AAA family ATPase -
  AB478_RS05555 (AB478_05380) - 1094268..1095188 (+) 921 WP_000138475.1 recombinase RecT -
  AB478_RS05560 (AB478_05385) - 1095269..1095886 (+) 618 WP_072528355.1 MBL fold metallo-hydrolase -
  AB478_RS05565 (AB478_05390) ssbA 1095887..1096357 (+) 471 WP_099143902.1 single-stranded DNA-binding protein Machinery gene
  AB478_RS05570 (AB478_05395) - 1096387..1097271 (+) 885 WP_099143903.1 DnaD domain protein -
  AB478_RS05575 (AB478_05400) - 1097278..1097496 (+) 219 WP_000338528.1 hypothetical protein -
  AB478_RS05580 (AB478_05405) - 1097505..1097909 (+) 405 WP_000401972.1 RusA family crossover junction endodeoxyribonuclease -
  AB478_RS05585 (AB478_05410) - 1097922..1098293 (+) 372 WP_061393904.1 SA1788 family PVL leukocidin-associated protein -
  AB478_RS05590 (AB478_05415) - 1098294..1098542 (+) 249 WP_001126832.1 phi PVL orf 51-like protein -
  AB478_RS05595 (AB478_05420) - 1098555..1098956 (+) 402 WP_000695766.1 hypothetical protein -
  AB478_RS05600 (AB478_05425) - 1098953..1099336 (+) 384 WP_053007324.1 YopX family protein -
  AB478_RS05605 (AB478_05430) - 1099333..1099683 (+) 351 WP_099143904.1 hypothetical protein -
  AB478_RS05610 (AB478_05435) - 1099676..1099921 (+) 246 WP_099143905.1 DUF1024 family protein -
  AB478_RS05615 (AB478_05440) - 1099918..1100454 (+) 537 WP_000185693.1 dUTPase -
  AB478_RS05620 (AB478_05445) - 1100494..1100697 (+) 204 Protein_1055 DUF1381 domain-containing protein -
  AB478_RS05625 (AB478_05450) - 1100694..1100897 (+) 204 WP_001072795.1 hypothetical protein -
  AB478_RS05630 (AB478_05455) - 1100890..1101126 (+) 237 WP_000608278.1 DUF7366 family protein -
  AB478_RS05635 (AB478_05460) - 1101116..1101505 (+) 390 WP_001662395.1 hypothetical protein -
  AB478_RS05640 (AB478_05465) rinB 1101502..1101675 (+) 174 WP_000595257.1 transcriptional activator RinB -
  AB478_RS05645 (AB478_05470) - 1101676..1102077 (+) 402 WP_033858146.1 hypothetical protein -
  AB478_RS05655 (AB478_05475) - 1102429..1102923 (+) 495 WP_000594088.1 terminase small subunit -
  AB478_RS05660 (AB478_05480) - 1102916..1104139 (+) 1224 WP_001037578.1 PBSX family phage terminase large subunit -
  AB478_RS05665 (AB478_05485) - 1104136..1105560 (+) 1425 WP_031771035.1 phage portal protein -
  AB478_RS05670 (AB478_05490) - 1105529..1106479 (+) 951 WP_001652283.1 phage head morphogenesis protein -
  AB478_RS05675 (AB478_05495) - 1106575..1107159 (+) 585 WP_054189012.1 DUF4355 domain-containing protein -
  AB478_RS05680 (AB478_05500) - 1107176..1108090 (+) 915 WP_000235168.1 phage major capsid protein -
  AB478_RS14160 - 1108102..1108245 (+) 144 WP_000002931.1 hypothetical protein -
  AB478_RS05685 (AB478_05505) - 1108251..1108601 (+) 351 WP_000177351.1 phage head-tail adapter protein -
  AB478_RS05690 (AB478_05510) - 1108613..1108948 (+) 336 WP_031923493.1 phage head closure protein -
  AB478_RS05695 (AB478_05515) - 1108935..1109342 (+) 408 WP_001151323.1 HK97-gp10 family putative phage morphogenesis protein -
  AB478_RS05700 (AB478_05520) - 1109355..1109780 (+) 426 WP_000270190.1 DUF3168 domain-containing protein -
  AB478_RS05705 (AB478_05525) - 1109781..1110338 (+) 558 WP_000057584.1 hypothetical protein -
  AB478_RS05710 (AB478_05530) - 1110405..1110911 (+) 507 WP_000134337.1 tail assembly chaperone -
  AB478_RS05715 (AB478_05535) - 1110956..1111240 (+) 285 WP_000880587.1 hypothetical protein -
  AB478_RS05720 (AB478_05540) - 1111244..1114129 (+) 2886 WP_099143906.1 terminase -
  AB478_RS05725 (AB478_05545) - 1114144..1115085 (+) 942 WP_031923496.1 phage tail domain-containing protein -
  AB478_RS05730 (AB478_05550) - 1115096..1116982 (+) 1887 WP_031771031.1 SGNH/GDSL hydrolase family protein -
  AB478_RS05735 (AB478_05555) - 1116995..1118893 (+) 1899 WP_031771029.1 hypothetical protein -
  AB478_RS05740 (AB478_05560) - 1118893..1120716 (+) 1824 WP_031771028.1 phage baseplate upper protein -
  AB478_RS05745 (AB478_05565) - 1120716..1121093 (+) 378 WP_000705896.1 DUF2977 domain-containing protein -
  AB478_RS05750 (AB478_05570) - 1121097..1121270 (+) 174 WP_000782200.1 XkdX family protein -
  AB478_RS05755 (AB478_05575) - 1121310..1121609 (+) 300 WP_000466777.1 DUF2951 domain-containing protein -
  AB478_RS05760 (AB478_05580) - 1121746..1123620 (+) 1875 WP_099143907.1 glucosaminidase domain-containing protein -
  AB478_RS05765 (AB478_05585) - 1123633..1124805 (+) 1173 WP_099143908.1 BppU family phage baseplate upper protein -
  AB478_RS05770 (AB478_05590) - 1124811..1125206 (+) 396 WP_015978410.1 hypothetical protein -
  AB478_RS05775 (AB478_05595) - 1125262..1125699 (+) 438 WP_029549399.1 phage holin -
  AB478_RS05780 (AB478_05600) - 1125680..1127125 (+) 1446 WP_001148135.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17637.53 Da        Isoelectric Point: 5.2672

>NTDB_id=201588 AB478_RS05565 WP_099143902.1 1095887..1096357(+) (ssbA) [Staphylococcus aureus strain CFSAN007883]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNPNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=201588 AB478_RS05565 WP_099143902.1 1095887..1096357(+) (ssbA) [Staphylococcus aureus strain CFSAN007883]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGCAGATTACAAACGCGT
AACTATGAAAACAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAGTTTTTAGAACCGAAAAA
CCCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGGCAATCACAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558

  ssbB Bacillus subtilis subsp. subtilis str. 168

57.018

73.077

0.417

  ssb Vibrio cholerae strain A1552

31.016

100

0.372


Multiple sequence alignment