Detailed information
Overview
| Name | recA | Type | Machinery gene |
| Locus tag | SSU05_0063 | Genome accession | CP000407 |
| Coordinates | 67749..67841 (+) | Length | 30 a.a. |
| NCBI ID | ABP89035.1 | Uniprot ID | - |
| Organism | Streptococcus suis 05ZYH33 | ||
| Function | homologous recombination (predicted from homology) Homologous recombination |
||
Genomic Context
Location: 62749..72841
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SSU05_0060 | ruvA | 64526..65116 (+) | 591 | ABP89032.1 | Holliday junction resolvasome, DNA-binding subunit | Machinery gene |
| SSU05_0061 | - | 65757..66410 (+) | 654 | ABP89033.1 | 3-methyladenine DNA glycosylase | - |
| SSU05_0062 | cinA | 66411..67628 (+) | 1218 | ABP89034.1 | Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA | Machinery gene |
| SSU05_0063 | recA | 67749..67841 (+) | 93 | ABP89035.1 | recombination protein A | Machinery gene |
| SSU05_0064 | recA | 67866..68831 (+) | 966 | ABP89036.1 | RecA/RadA recombinase | Machinery gene |
| SSU05_0065 | - | 69067..69465 (+) | 399 | ABP89037.1 | Arsenate reductase and related protein, glutaredoxin family | - |
| SSU05_0066 | - | 69565..69831 (+) | 267 | ABP89038.1 | Uncharacterized protein conserved in bacteria | - |
| SSU05_0067 | - | 69831..70250 (+) | 420 | ABP89039.1 | Unknown protein | - |
| SSU05_0068 | - | 70262..70582 (+) | 321 | ABP89040.1 | Uncharacterized protein conserved in bacteria | - |
| SSU05_0069 | - | 70754..71368 (+) | 615 | ABP89041.1 | Uncharacterized protein conserved in bacteria | - |
| SSU05_0070 | - | 71809..72339 (+) | 531 | ABP89042.1 | ribosomal protein S10 | - |
Sequence
Protein
Download Length: 30 a.a. Molecular weight: 3337.86 Da Isoelectric Point: 8.7905
>NTDB_id=20114 SSU05_0063 ABP89035.1 67749..67841(+) (recA) [Streptococcus suis 05ZYH33]
MDDALKSIEKDFGKGAVMRLGERAEQKVKS
MDDALKSIEKDFGKGAVMRLGERAEQKVKS
Nucleotide
Download Length: 93 bp
>NTDB_id=20114 SSU05_0063 ABP89035.1 67749..67841(+) (recA) [Streptococcus suis 05ZYH33]
TTGGATGATGCCCTAAAATCAATTGAAAAAGATTTTGGTAAGGGTGCTGTTATGCGTCTTGGTGAGCGTGCTGAGCAAAA
AGTCAAGTCATGA
TTGGATGATGCCCTAAAATCAATTGAAAAAGATTTTGGTAAGGGTGCTGTTATGCGTCTTGGTGAGCGTGCTGAGCAAAA
AGTCAAGTCATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.