Detailed information NTG0195885

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: LCW_RS00040
• Genome accession: NZ_CP017124
• Coordinates: 9504..10016 (+)
• Length: 170 a.a.
• NCBI ID: WP_004265848.1
• Uniprot ID: A0A0B2XPH3
• Organism: Latilactobacillus curvatus strain WiKim38
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	1530..20088	9504..10016	within	0

Gene organization within MGE regions

Location: 1530..20088

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LCW_RS00010 (LCW_00010)	dnaN	1530..2669 (+)	1140	WP_069467794.1	DNA polymerase III subunit beta	-
LCW_RS00015 (LCW_00015)	yaaA	2907..3134 (+)	228	WP_064776770.1	S4 domain-containing protein YaaA	-
LCW_RS00020 (LCW_00020)	recF	3141..4274 (+)	1134	WP_039098085.1	DNA replication/repair protein RecF	-
LCW_RS00025 (LCW_00025)	gyrB	4320..6281 (+)	1962	WP_069468526.1	DNA topoisomerase (ATP-hydrolyzing) subunit B	-
LCW_RS00030 (LCW_00030)	gyrA	6340..8925 (+)	2586	WP_039098084.1	DNA gyrase subunit A	-
LCW_RS00035 (LCW_00035)	rpsF	9168..9464 (+)	297	WP_004265809.1	30S ribosomal protein S6	-
LCW_RS00040 (LCW_00040)	ssb	9504..10016 (+)	513	WP_004265848.1	single-stranded DNA-binding protein	Machinery gene
LCW_RS00045 (LCW_00045)	rpsR	10047..10286 (+)	240	WP_004265822.1	30S ribosomal protein S18	-
LCW_RS00050 (LCW_00050)	-	10503..12533 (+)	2031	WP_069467795.1	DHH family phosphoesterase	-
LCW_RS00055 (LCW_00055)	rplI	12555..13007 (+)	453	WP_064776768.1	50S ribosomal protein L9	-
LCW_RS00060 (LCW_00060)	dnaB	13152..14555 (+)	1404	WP_172821848.1	replicative DNA helicase	-
LCW_RS00065 (LCW_00065)	-	14875..15804 (+)	930	WP_003592463.1	IS30-like element ISLpl1 family transposase	-
LCW_RS00070 (LCW_00070)	-	15976..17322 (-)	1347	WP_069467796.1	nucleobase:cation symporter-2 family protein	-
LCW_RS00075 (LCW_00075)	rsmG	17690..18430 (+)	741	WP_064776763.1	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	-
LCW_RS00080 (LCW_00080)	noc	18430..19308 (+)	879	WP_004265810.1	nucleoid occlusion protein	-
LCW_RS00085 (LCW_00085)	-	19321..20088 (+)	768	WP_004265824.1	ParA family protein	-

Sequence

Protein

• Length: 170 a.a.
• Molecular weight: 18621.16 Da
• Isoelectric Point: 4.6856

>NTDB_id=195885 LCW_RS00040 WP_004265848.1 9504..10016(+) (ssb) [Latilactobacillus curvatus strain WiKim38]
MINRVVLVGRLTRDVDLRYTSSGAAVGTFSIAVNRQFTNANGDREADFINCVIWRKSAENFANFTKKGSLVGVDGRLQTR
NYENQQGQRVYVTEVVVDNFSLLESRTTTEQRQGDGASQNFNNNQSNGSQQSGFTSPQQSGNPSAANNTQADPFANNGQA
IDISDDDLPF

Nucleotide

• Length: 513 bp

>NTDB_id=195885 LCW_RS00040 WP_004265848.1 9504..10016(+) (ssb) [Latilactobacillus curvatus strain WiKim38]
ATGATTAATCGAGTTGTACTCGTTGGTCGGCTAACACGCGATGTTGACTTACGTTACACTTCTAGTGGTGCTGCTGTTGG
GACTTTCTCAATCGCAGTGAACCGTCAATTCACGAATGCCAATGGTGATCGTGAAGCAGACTTTATCAACTGTGTCATCT
GGCGTAAATCAGCGGAAAATTTCGCTAATTTCACTAAGAAAGGCTCACTAGTCGGAGTTGATGGCCGTCTACAAACGAGA
AATTATGAAAACCAACAAGGTCAACGTGTATACGTAACCGAAGTGGTCGTTGATAACTTCTCATTGTTAGAATCACGGAC
AACAACGGAGCAACGGCAAGGGGATGGCGCAAGCCAAAACTTTAACAACAATCAAAGCAATGGTAGCCAACAATCTGGAT
TTACTAGCCCTCAACAATCGGGTAATCCATCAGCTGCAAATAACACTCAAGCCGATCCATTTGCAAATAATGGTCAAGCA
ATTGATATTTCAGATGATGATTTACCTTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-102)

3D structure

• AlphaFold DB: A0A0B2XPH3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Latilactobacillus sakei subsp. sakei 23K	97.059	100	0.971
ssbA	Bacillus subtilis subsp. subtilis str. 168	56	100	0.576
ssbB	Bacillus subtilis subsp. subtilis str. 168	59.434	62.353	0.371
ssb	Glaesserella parasuis strain SC1401	33.155	100	0.365