Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BFI33_RS13455 Genome accession   NZ_CP016852
Coordinates   2555509..2555883 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. subtilis strain 168G     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2550509..2560883
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BFI33_RS13415 (BFI33_13415) yqhG 2550841..2551635 (+) 795 WP_003230200.1 YqhG family protein -
  BFI33_RS13420 (BFI33_13420) sinI 2551818..2551991 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BFI33_RS13425 (BFI33_13425) sinR 2552025..2552360 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BFI33_RS13430 (BFI33_13430) tasA 2552453..2553238 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BFI33_RS13435 (BFI33_13435) sipW 2553302..2553874 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BFI33_RS13440 (BFI33_13440) tapA 2553858..2554619 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  BFI33_RS13445 (BFI33_13445) yqzG 2554891..2555217 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BFI33_RS13450 (BFI33_13450) spoIITA 2555259..2555438 (-) 180 WP_003230176.1 YqzE family protein -
  BFI33_RS13455 (BFI33_13455) comGG 2555509..2555883 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  BFI33_RS13460 (BFI33_13460) comGF 2555884..2556267 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  BFI33_RS13465 (BFI33_13465) comGE 2556293..2556640 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  BFI33_RS13470 (BFI33_13470) comGD 2556624..2557055 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  BFI33_RS13475 (BFI33_13475) comGC 2557045..2557341 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BFI33_RS13480 (BFI33_13480) comGB 2557355..2558392 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  BFI33_RS13485 (BFI33_13485) comGA 2558379..2559449 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BFI33_RS13495 (BFI33_13495) corA 2559861..2560814 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=192778 BFI33_RS13455 WP_003230170.1 2555509..2555883(-) (comGG) [Bacillus subtilis subsp. subtilis strain 168G]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=192778 BFI33_RS13455 WP_003230170.1 2555509..2555883(-) (comGG) [Bacillus subtilis subsp. subtilis strain 168G]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment