Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BFI33_RS13420 | Genome accession | NZ_CP016852 |
| Coordinates | 2551818..2551991 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain 168G | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2546818..2556991
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BFI33_RS13405 (BFI33_13405) | gcvT | 2547617..2548705 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BFI33_RS13410 (BFI33_13410) | hepAA | 2549147..2550820 (+) | 1674 | WP_004398544.1 | DEAD/DEAH box helicase | - |
| BFI33_RS13415 (BFI33_13415) | yqhG | 2550841..2551635 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| BFI33_RS13420 (BFI33_13420) | sinI | 2551818..2551991 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| BFI33_RS13425 (BFI33_13425) | sinR | 2552025..2552360 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| BFI33_RS13430 (BFI33_13430) | tasA | 2552453..2553238 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| BFI33_RS13435 (BFI33_13435) | sipW | 2553302..2553874 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| BFI33_RS13440 (BFI33_13440) | tapA | 2553858..2554619 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BFI33_RS13445 (BFI33_13445) | yqzG | 2554891..2555217 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| BFI33_RS13450 (BFI33_13450) | spoIITA | 2555259..2555438 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| BFI33_RS13455 (BFI33_13455) | comGG | 2555509..2555883 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| BFI33_RS13460 (BFI33_13460) | comGF | 2555884..2556267 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| BFI33_RS13465 (BFI33_13465) | comGE | 2556293..2556640 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=192776 BFI33_RS13420 WP_003230187.1 2551818..2551991(+) (sinI) [Bacillus subtilis subsp. subtilis strain 168G]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=192776 BFI33_RS13420 WP_003230187.1 2551818..2551991(+) (sinI) [Bacillus subtilis subsp. subtilis strain 168G]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |