Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | FORC41_RS07860 | Genome accession | NZ_CP016628 |
| Coordinates | 1512777..1513292 (-) | Length | 171 a.a. |
| NCBI ID | WP_061091608.1 | Uniprot ID | - |
| Organism | Escherichia coli strain FORC_041 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1508676..1548224 | 1512777..1513292 | within | 0 |
Gene organization within MGE regions
Location: 1508676..1548224
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC41_RS07800 (FORC41_1436) | torI | 1508676..1508876 (-) | 201 | WP_001163428.1 | response regulator inhibitor TorI | - |
| FORC41_RS07805 | - | 1508934..1509101 (-) | 168 | WP_071974529.1 | hypothetical protein | - |
| FORC41_RS07810 (FORC41_1437) | - | 1509260..1509538 (-) | 279 | WP_016063072.1 | DUF4752 family protein | - |
| FORC41_RS07815 (FORC41_1438) | - | 1509538..1509750 (-) | 213 | WP_004031456.1 | hypothetical protein | - |
| FORC41_RS07820 (FORC41_1439) | - | 1509747..1510109 (-) | 363 | WP_236922830.1 | DUF551 domain-containing protein | - |
| FORC41_RS26840 | - | 1510107..1510232 (-) | 126 | Protein_1424 | hypothetical protein | - |
| FORC41_RS07825 (FORC41_1440) | - | 1510234..1510641 (-) | 408 | WP_071974530.1 | ead/Ea22-like family protein | - |
| FORC41_RS07830 (FORC41_1441) | - | 1510628..1510945 (-) | 318 | WP_001543895.1 | hypothetical protein | - |
| FORC41_RS07835 (FORC41_1442) | - | 1510948..1511448 (-) | 501 | WP_001543894.1 | hypothetical protein | - |
| FORC41_RS07840 (FORC41_1443) | - | 1511445..1511609 (-) | 165 | WP_001214456.1 | DUF2737 family protein | - |
| FORC41_RS07845 (FORC41_1444) | - | 1511606..1511887 (-) | 282 | WP_000773123.1 | DUF5405 family protein | - |
| FORC41_RS07850 (FORC41_1445) | - | 1511907..1512203 (-) | 297 | WP_001111299.1 | phage anti-RecBCD protein | - |
| FORC41_RS07855 (FORC41_1446) | - | 1512220..1512768 (-) | 549 | WP_001016186.1 | 3'-5' exonuclease | - |
| FORC41_RS07860 (FORC41_1447) | ssb | 1512777..1513292 (-) | 516 | WP_061091608.1 | single-stranded DNA-binding protein | Machinery gene |
| FORC41_RS07865 (FORC41_1448) | - | 1513293..1514000 (-) | 708 | WP_033803013.1 | Rad52/Rad22 family DNA repair protein | - |
| FORC41_RS26510 (FORC41_1449) | - | 1514100..1514258 (-) | 159 | WP_059320584.1 | hypothetical protein | - |
| FORC41_RS07880 (FORC41_1450) | kil | 1514255..1514407 (-) | 153 | WP_001243355.1 | host cell division inhibitory peptide Kil | - |
| FORC41_RS27215 (FORC41_1451) | - | 1514392..1514526 (-) | 135 | WP_000972063.1 | hypothetical protein | - |
| FORC41_RS26515 | - | 1514751..1515335 (-) | 585 | WP_236922831.1 | Nmad5 family putative nucleotide modification protein | - |
| FORC41_RS27220 (FORC41_1453) | - | 1515386..1515712 (-) | 327 | WP_000340008.1 | antitermination protein N | - |
| FORC41_RS07900 (FORC41_1454) | - | 1516174..1516485 (-) | 312 | WP_236922829.1 | hypothetical protein | - |
| FORC41_RS07905 (FORC41_1455) | - | 1516575..1517207 (-) | 633 | WP_000028392.1 | LexA family protein | - |
| FORC41_RS07910 (FORC41_1456) | - | 1517311..1517526 (+) | 216 | WP_001194218.1 | helix-turn-helix domain-containing protein | - |
| FORC41_RS07915 (FORC41_1457) | - | 1517646..1517924 (+) | 279 | WP_001177653.1 | lambda phage CII family protein | - |
| FORC41_RS26520 (FORC41_1458) | - | 1517959..1518120 (+) | 162 | WP_000166961.1 | hypothetical protein | - |
| FORC41_RS07920 (FORC41_1459) | - | 1518107..1518997 (+) | 891 | WP_015973882.1 | hypothetical protein | - |
| FORC41_RS07925 (FORC41_1460) | - | 1518987..1520423 (+) | 1437 | WP_015980126.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| FORC41_RS07930 (FORC41_1462) | - | 1520500..1520940 (+) | 441 | WP_015980180.1 | recombination protein NinB | - |
| FORC41_RS07935 (FORC41_1463) | - | 1520937..1521809 (+) | 873 | WP_064236817.1 | phosphoadenosine phosphosulfate reductase family protein | - |
| FORC41_RS07940 | ninD | 1521809..1521979 (+) | 171 | WP_223368622.1 | protein NinD | - |
| FORC41_RS07945 | - | 1521946..1522122 (+) | 177 | WP_047624829.1 | NinE family protein | - |
| FORC41_RS07950 (FORC41_1464) | - | 1522125..1522526 (+) | 402 | WP_000924594.1 | hypothetical protein | - |
| FORC41_RS07955 (FORC41_1465) | - | 1522486..1522695 (+) | 210 | WP_021514114.1 | protein NinF | - |
| FORC41_RS07960 (FORC41_1466) | - | 1522688..1522957 (+) | 270 | WP_001279421.1 | hypothetical protein | - |
| FORC41_RS07965 (FORC41_1467) | - | 1522957..1523568 (+) | 612 | WP_042111340.1 | recombination protein NinG | - |
| FORC41_RS07970 (FORC41_1468) | - | 1523565..1523771 (+) | 207 | WP_000144614.1 | phage NinH family protein | - |
| FORC41_RS07975 (FORC41_1469) | - | 1523749..1524414 (+) | 666 | WP_071974532.1 | serine/threonine protein phosphatase | - |
| FORC41_RS07980 (FORC41_1470) | - | 1524411..1525034 (+) | 624 | WP_001235461.1 | antitermination protein | - |
| FORC41_RS08000 (FORC41_1471) | - | 1525707..1526030 (+) | 324 | WP_000783734.1 | phage holin, lambda family | - |
| FORC41_RS08005 (FORC41_1472) | - | 1526014..1526490 (+) | 477 | WP_071974533.1 | glycoside hydrolase family 104 protein | - |
| FORC41_RS08010 (FORC41_1473) | - | 1526487..1526954 (+) | 468 | WP_021527495.1 | lysis protein | - |
| FORC41_RS08015 (FORC41_1474) | - | 1526942..1527094 (+) | 153 | WP_001139676.1 | hypothetical protein | - |
| FORC41_RS08020 (FORC41_1475) | - | 1527301..1527843 (+) | 543 | WP_001109020.1 | Rha family transcriptional regulator | - |
| FORC41_RS08025 (FORC41_1476) | - | 1528002..1528382 (+) | 381 | WP_000999686.1 | Gp49 family protein | - |
| FORC41_RS08030 (FORC41_1477) | - | 1528486..1528728 (+) | 243 | WP_000807788.1 | DUF2560 family protein | - |
| FORC41_RS08035 (FORC41_1478) | - | 1528808..1529233 (+) | 426 | WP_000179913.1 | hypothetical protein | - |
| FORC41_RS08040 (FORC41_1479) | - | 1529230..1530645 (+) | 1416 | WP_071974534.1 | PBSX family phage terminase large subunit | - |
| FORC41_RS08045 (FORC41_1480) | - | 1530647..1532845 (+) | 2199 | WP_000818368.1 | portal protein | - |
| FORC41_RS08050 (FORC41_1481) | - | 1532936..1533829 (+) | 894 | WP_071974535.1 | scaffolding protein | - |
| FORC41_RS08055 (FORC41_1482) | - | 1533848..1535101 (+) | 1254 | WP_071974536.1 | P22 phage major capsid protein family protein | - |
| FORC41_RS08060 (FORC41_1483) | - | 1535143..1535331 (+) | 189 | WP_032198660.1 | hypothetical protein | - |
| FORC41_RS08065 (FORC41_1484) | - | 1535312..1535773 (+) | 462 | WP_001140510.1 | packaged DNA stabilization gp4 family protein | - |
| FORC41_RS08070 (FORC41_1485) | - | 1535783..1537201 (+) | 1419 | WP_071974537.1 | packaged DNA stabilization protein gp10 | - |
| FORC41_RS08075 (FORC41_1486) | - | 1537201..1537902 (+) | 702 | WP_071974538.1 | phage tail protein | - |
| FORC41_RS08080 (FORC41_1487) | - | 1537902..1538357 (+) | 456 | WP_071974539.1 | DUF2824 family protein | - |
| FORC41_RS08085 (FORC41_1488) | - | 1538360..1539052 (+) | 693 | WP_071974540.1 | DNA transfer protein | - |
| FORC41_RS08090 (FORC41_1489) | - | 1539062..1540327 (+) | 1266 | WP_071974541.1 | phage DNA ejection protein | - |
| FORC41_RS08095 (FORC41_1490) | - | 1540327..1542441 (+) | 2115 | WP_071974542.1 | DNA transfer protein | - |
| FORC41_RS08100 (FORC41_1491) | - | 1542444..1542929 (-) | 486 | WP_071974543.1 | hypothetical protein | - |
| FORC41_RS08105 (FORC41_1492) | - | 1543000..1543266 (-) | 267 | WP_000287055.1 | Arc family DNA-binding protein | - |
| FORC41_RS26850 (FORC41_1493) | - | 1543388..1545589 (+) | 2202 | WP_071974544.1 | phage tailspike protein | - |
| FORC41_RS08115 (FORC41_1494) | - | 1545661..1546653 (-) | 993 | WP_071974545.1 | acyltransferase family protein | - |
| FORC41_RS08120 (FORC41_1495) | intS | 1547067..1548224 (-) | 1158 | WP_071974546.1 | prophage integrase IntS | - |
Sequence
Protein
Download Length: 171 a.a. Molecular weight: 19154.34 Da Isoelectric Point: 7.4686
>NTDB_id=189812 FORC41_RS07860 WP_061091608.1 1512777..1513292(-) (ssb) [Escherichia coli strain FORC_041]
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMIGGKQGGNEQSSPQRNNGQQQRQQPQQQGNHSEPPMDFDDDIPFAPVT
LPFPRHAIHAI
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMIGGKQGGNEQSSPQRNNGQQQRQQPQQQGNHSEPPMDFDDDIPFAPVT
LPFPRHAIHAI
Nucleotide
Download Length: 516 bp
>NTDB_id=189812 FORC41_RS07860 WP_061091608.1 1512777..1513292(-) (ssb) [Escherichia coli strain FORC_041]
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGCAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGCGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAATATCTGCGAAAAGGCTCTGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGCGGACAGGATCGGTTCACTACTGAAGTCATCGTGGGCGTTGG
TGGAACTATGCAAATGATTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAACGGTCAGCAACAAA
GACAGCAACCTCAGCAGCAAGGGAATCACAGCGAACCACCTATGGATTTTGACGACGATATACCCTTTGCACCAGTAACT
CTCCCCTTCCCTCGTCACGCTATTCACGCAATTTAA
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGCAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGCGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAATATCTGCGAAAAGGCTCTGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGCGGACAGGATCGGTTCACTACTGAAGTCATCGTGGGCGTTGG
TGGAACTATGCAAATGATTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAACGGTCAGCAACAAA
GACAGCAACCTCAGCAGCAAGGGAATCACAGCGAACCACCTATGGATTTTGACGACGATATACCCTTTGCACCAGTAACT
CTCCCCTTCCCTCGTCACGCTATTCACGCAATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
62.147 |
100 |
0.643 |
| ssb | Glaesserella parasuis strain SC1401 |
51.934 |
100 |
0.55 |
| ssb | Neisseria gonorrhoeae MS11 |
41.477 |
100 |
0.427 |
| ssb | Neisseria meningitidis MC58 |
40.909 |
100 |
0.421 |