Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   BBI08_RS10680 Genome accession   NZ_CP016537
Coordinates   2112220..2112645 (-) Length   141 a.a.
NCBI ID   WP_083383313.1    Uniprot ID   -
Organism   Planococcus halocryophilus strain DSM 24743     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2071740..2125638 2112220..2112645 within 0


Gene organization within MGE regions


Location: 2071740..2125638
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BBI08_RS10440 (BBI08_06115) - 2071740..2071973 (-) 234 WP_008430945.1 DUF896 domain-containing protein -
  BBI08_RS10445 (BBI08_06120) - 2072032..2072685 (-) 654 WP_008497831.1 YneB family resolvase-like protein -
  BBI08_RS10450 (BBI08_06125) - 2072682..2072999 (-) 318 WP_008497832.1 cell division suppressor protein YneA -
  BBI08_RS10455 (BBI08_06130) lexA 2073165..2073785 (+) 621 WP_008497833.1 transcriptional repressor LexA -
  BBI08_RS10460 (BBI08_06135) - 2074071..2074805 (-) 735 WP_008497834.1 class I SAM-dependent methyltransferase -
  BBI08_RS10465 (BBI08_06140) - 2074908..2075102 (-) 195 WP_008497835.1 hypothetical protein -
  BBI08_RS10470 (BBI08_06145) - 2075172..2075621 (-) 450 WP_008497836.1 hypothetical protein -
  BBI08_RS10475 (BBI08_06150) - 2075732..2075938 (-) 207 WP_040850935.1 hypothetical protein -
  BBI08_RS10485 (BBI08_06165) - 2077566..2078327 (-) 762 WP_040850873.1 hypothetical protein -
  BBI08_RS10490 (BBI08_06170) - 2078756..2079790 (-) 1035 WP_169819301.1 Abi family protein -
  BBI08_RS10495 (BBI08_06175) - 2080091..2080453 (-) 363 WP_051041695.1 YolD-like family protein -
  BBI08_RS10500 (BBI08_06180) - 2080577..2081437 (-) 861 WP_065528073.1 N-acetylmuramoyl-L-alanine amidase -
  BBI08_RS10505 (BBI08_06185) - 2081418..2081708 (-) 291 WP_008497845.1 holin -
  BBI08_RS10510 (BBI08_06190) - 2081711..2082247 (-) 537 WP_169819302.1 phage holin family protein -
  BBI08_RS10515 (BBI08_06195) - 2082916..2083350 (-) 435 WP_205847833.1 GNAT family N-acetyltransferase -
  BBI08_RS10520 (BBI08_06200) - 2083392..2083646 (-) 255 WP_040850876.1 hypothetical protein -
  BBI08_RS10525 (BBI08_06205) - 2083702..2083926 (-) 225 WP_008497850.1 hypothetical protein -
  BBI08_RS10530 (BBI08_06210) - 2083923..2084375 (-) 453 WP_008497851.1 hypothetical protein -
  BBI08_RS10535 (BBI08_06215) - 2084391..2090156 (-) 5766 WP_065528075.1 phage tail spike protein -
  BBI08_RS10540 (BBI08_06220) - 2090153..2091595 (-) 1443 WP_008497855.1 distal tail protein Dit -
  BBI08_RS10545 (BBI08_06225) - 2091608..2096266 (-) 4659 WP_008497856.1 peptidoglycan DD-metalloendopeptidase family protein -
  BBI08_RS10550 (BBI08_06230) - 2096267..2096506 (-) 240 WP_205847834.1 hypothetical protein -
  BBI08_RS10555 (BBI08_06235) - 2096614..2097084 (-) 471 WP_065528076.1 hypothetical protein -
  BBI08_RS10560 (BBI08_06240) - 2097154..2097726 (-) 573 WP_008497859.1 hypothetical protein -
  BBI08_RS10565 (BBI08_06245) - 2097723..2098145 (-) 423 WP_008497860.1 hypothetical protein -
  BBI08_RS10570 (BBI08_06250) - 2098145..2098618 (-) 474 WP_040850938.1 HK97 gp10 family phage protein -
  BBI08_RS10575 (BBI08_06255) - 2098626..2098970 (-) 345 WP_008497862.1 hypothetical protein -
  BBI08_RS10580 (BBI08_06260) - 2098967..2099308 (-) 342 WP_008497863.1 hypothetical protein -
  BBI08_RS10585 (BBI08_06265) - 2099322..2099579 (-) 258 WP_008497864.1 Rho termination factor N-terminal domain-containing protein -
  BBI08_RS10590 (BBI08_06270) - 2099624..2100613 (-) 990 WP_008497865.1 major capsid protein -
  BBI08_RS10595 (BBI08_06275) - 2100641..2101003 (-) 363 WP_008497866.1 hypothetical protein -
  BBI08_RS10600 (BBI08_06280) - 2101000..2101614 (-) 615 WP_065528077.1 phage scaffolding protein -
  BBI08_RS10605 (BBI08_06285) - 2101831..2102925 (-) 1095 WP_008497870.1 phage minor capsid protein -
  BBI08_RS10610 (BBI08_06290) - 2102930..2104519 (-) 1590 WP_008497871.1 hypothetical protein -
  BBI08_RS10615 (BBI08_06295) - 2104533..2105804 (-) 1272 WP_008497872.1 PBSX family phage terminase large subunit -
  BBI08_RS10620 (BBI08_06300) - 2105794..2106243 (-) 450 WP_008497873.1 terminase small subunit -
  BBI08_RS10625 (BBI08_06305) - 2106598..2106813 (-) 216 WP_008497874.1 hypothetical protein -
  BBI08_RS10630 (BBI08_06310) - 2106876..2107364 (-) 489 WP_008497875.1 sigma-70 family RNA polymerase sigma factor -
  BBI08_RS10635 (BBI08_06315) - 2107462..2108244 (-) 783 WP_236610228.1 DUF5677 domain-containing protein -
  BBI08_RS10640 (BBI08_06320) - 2108309..2108845 (-) 537 WP_008497877.1 hypothetical protein -
  BBI08_RS10645 (BBI08_06325) - 2108915..2109562 (-) 648 WP_008497878.1 hypothetical protein -
  BBI08_RS10650 (BBI08_06330) - 2109559..2109750 (-) 192 WP_008497879.1 XtrA/YqaO family protein -
  BBI08_RS10655 (BBI08_06335) - 2109769..2109987 (-) 219 WP_040850882.1 hypothetical protein -
  BBI08_RS10660 (BBI08_06340) - 2110006..2110425 (-) 420 WP_040850883.1 RusA family crossover junction endodeoxyribonuclease -
  BBI08_RS17375 - 2110437..2110568 (-) 132 WP_008497880.1 hypothetical protein -
  BBI08_RS10665 (BBI08_06345) - 2110586..2110915 (-) 330 WP_237146534.1 MazG-like family protein -
  BBI08_RS10670 (BBI08_06350) - 2110912..2111151 (-) 240 WP_008497881.1 hypothetical protein -
  BBI08_RS17200 (BBI08_06355) - 2111497..2111688 (+) 192 WP_237146535.1 hypothetical protein -
  BBI08_RS17040 - 2111956..2112132 (-) 177 WP_008497884.1 hypothetical protein -
  BBI08_RS10680 (BBI08_06360) ssbA 2112220..2112645 (-) 426 WP_083383313.1 single-stranded DNA-binding protein Machinery gene
  BBI08_RS10685 (BBI08_06365) - 2112642..2112821 (-) 180 WP_008497886.1 hypothetical protein -
  BBI08_RS10690 (BBI08_06370) - 2112833..2113627 (-) 795 WP_237146536.1 ATP-binding protein -
  BBI08_RS10695 (BBI08_06375) - 2113596..2114453 (-) 858 WP_008497888.1 DnaD domain-containing protein -
  BBI08_RS10700 (BBI08_06380) - 2114476..2115177 (-) 702 WP_008497889.1 MBL fold metallo-hydrolase -
  BBI08_RS10705 (BBI08_06385) - 2115177..2116103 (-) 927 WP_008497890.1 RecT family recombinase -
  BBI08_RS10710 (BBI08_06390) - 2116105..2118078 (-) 1974 WP_065528078.1 AAA family ATPase -
  BBI08_RS10715 (BBI08_06395) - 2118180..2118560 (-) 381 WP_155800275.1 YqaI family protein -
  BBI08_RS10720 (BBI08_06400) - 2118557..2118784 (-) 228 WP_008497894.1 hypothetical protein -
  BBI08_RS10725 (BBI08_06405) - 2119045..2119575 (-) 531 WP_008497897.1 hypothetical protein -
  BBI08_RS10730 (BBI08_06410) - 2119664..2119942 (-) 279 WP_040850886.1 hypothetical protein -
  BBI08_RS10735 (BBI08_06415) - 2119983..2120636 (-) 654 WP_008497898.1 Rha family transcriptional regulator -
  BBI08_RS10740 (BBI08_06420) - 2120696..2121379 (+) 684 WP_008497899.1 hypothetical protein -
  BBI08_RS10745 (BBI08_06425) - 2121376..2121561 (-) 186 WP_008497900.1 hypothetical protein -
  BBI08_RS10750 (BBI08_06430) - 2121792..2122040 (-) 249 WP_008497901.1 helix-turn-helix transcriptional regulator -
  BBI08_RS10755 (BBI08_06435) - 2122195..2122578 (+) 384 WP_040850887.1 helix-turn-helix domain-containing protein -
  BBI08_RS10760 (BBI08_06440) - 2122732..2123706 (+) 975 WP_065528079.1 hypothetical protein -
  BBI08_RS10765 (BBI08_06445) - 2123784..2124245 (+) 462 WP_008497904.1 ImmA/IrrE family metallo-endopeptidase -
  BBI08_RS10770 (BBI08_06450) - 2124258..2124446 (+) 189 WP_008497905.1 hypothetical protein -
  BBI08_RS10775 (BBI08_06455) - 2124514..2125638 (+) 1125 WP_008497906.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 141 a.a.        Molecular weight: 15469.14 Da        Isoelectric Point: 4.9843

>NTDB_id=188920 BBI08_RS10680 WP_083383313.1 2112220..2112645(-) (ssbA) [Planococcus halocryophilus strain DSM 24743]
MINRVIMVGRLTKDPDLKYTASGAAVARFTLAVNRNFSNTNGEKETDFINCTVWRKQAENTANFLKKGSLAGVEGRIQTG
SYEGQDGKRVYTTEVVCDSVQFLEPKNTQAARNEASPATGDKEPVNAPEEHTGNPEDDLPF

Nucleotide


Download         Length: 426 bp        

>NTDB_id=188920 BBI08_RS10680 WP_083383313.1 2112220..2112645(-) (ssbA) [Planococcus halocryophilus strain DSM 24743]
TTGATCAACCGAGTAATAATGGTCGGAAGACTAACAAAAGATCCAGACTTAAAGTACACCGCTTCAGGAGCTGCAGTAGC
CAGGTTCACATTGGCAGTCAATCGAAACTTCTCCAATACAAACGGAGAAAAGGAAACAGACTTCATCAATTGCACGGTCT
GGCGAAAACAAGCCGAAAACACAGCAAACTTCTTAAAAAAAGGAAGTCTTGCTGGCGTCGAAGGCAGGATTCAAACCGGC
AGCTATGAAGGACAGGATGGCAAGCGGGTTTATACGACTGAAGTTGTTTGTGACAGCGTGCAATTCCTTGAACCTAAAAA
CACACAGGCGGCTAGAAATGAAGCTTCTCCAGCTACTGGCGATAAAGAACCGGTCAATGCGCCGGAAGAGCACACAGGCA
ATCCAGAGGACGATTTGCCGTTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

71.963

75.887

0.546
  ssb Latilactobacillus sakei subsp. sakei 23K

63.393

79.433

0.504
  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

75.177

0.482
  ssbB Streptococcus sobrinus strain NIDR 6715-7

42.975

85.816

0.369

Multiple sequence alignment