Detailed information NTG0185165

Bioinformatically predicted

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: A9Y60_RS01145
• Genome accession: NZ_CP016016
• Coordinates: 221086..221535 (+)
• Length: 149 a.a.
• NCBI ID: WP_002214937.1
• Uniprot ID: A0AA44U8B7
• Organism: Neisseria gonorrhoeae strain 34530
• Function: DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	213806..228510	221086..221535	within	0

Gene organization within MGE regions

Location: 213806..228510

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A9Y60_RS13800	-	213806..214150 (+)	345	WP_003691787.1	HAD hydrolase family protein	-
A9Y60_RS13805 (A9Y60_01105)	-	214104..214757 (+)	654	Protein_203	TIGR01621 family pseudouridine synthase	-
A9Y60_RS14785	-	220382..220498 (+)	117	Protein_204	competence protein ComE	-
A9Y60_RS01140 (A9Y60_01140)	comE	220603..220998 (+)	396	WP_003703428.1	helix-hairpin-helix domain-containing protein	Machinery gene
A9Y60_RS01145 (A9Y60_01145)	comP	221086..221535 (+)	450	WP_002214937.1	type IV pilin protein	Machinery gene
A9Y60_RS01150 (A9Y60_01150)	-	221912..222058 (-)	147	WP_003691757.1	hypothetical protein	-
A9Y60_RS01155 (A9Y60_01155)	-	222445..223035 (+)	591	WP_080229150.1	DNA cytosine methyltransferase	-
A9Y60_RS01160 (A9Y60_01160)	-	223032..223403 (+)	372	WP_012503918.1	DNA cytosine methyltransferase	-
A9Y60_RS14790	-	223417..224274 (+)	858	WP_012503917.1	ATP-binding protein	-
A9Y60_RS14795	-	224464..225060 (+)	597	WP_012503916.1	TIGR02391 family protein	-
A9Y60_RS01170 (A9Y60_01170)	-	225066..225488 (+)	423	WP_003691751.1	very short patch repair endonuclease	-
A9Y60_RS01175 (A9Y60_01175)	-	225800..226951 (+)	1152	WP_186334060.1	replication initiation factor domain-containing protein	-
A9Y60_RS01180 (A9Y60_01180)	-	226996..227286 (+)	291	WP_002216601.1	hypothetical protein	-
A9Y60_RS01185 (A9Y60_01185)	-	227291..227488 (+)	198	WP_003689600.1	hypothetical protein	-
A9Y60_RS01190 (A9Y60_01190)	-	227562..227780 (+)	219	WP_003691584.1	major capsid protein	-
A9Y60_RS01195 (A9Y60_01195)	-	227787..228065 (+)	279	WP_003689168.1	hypothetical protein	-
A9Y60_RS01200 (A9Y60_01200)	-	228193..228510 (+)	318	WP_003689167.1	DUF1132 family protein	-

Sequence

Protein

• Length: 149 a.a.
• Molecular weight: 16834.81 Da
• Isoelectric Point: 9.7951

>NTDB_id=185165 A9Y60_RS01145 WP_002214937.1 221086..221535(+) (comP) [Neisseria gonorrhoeae strain 34530]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK

Nucleotide

• Length: 450 bp

>NTDB_id=185165 A9Y60_RS01145 WP_002214937.1 221086..221535(+) (comP) [Neisseria gonorrhoeae strain 34530]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG

Domains

Predicted by InterproScan.

• Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS) (28-107)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comP	Neisseria gonorrhoeae MS11	100	100	1
comP	Neisseria meningitidis 8013	99.329	100	0.993
comP	Neisseria subflava NJ9703	49.66	98.658	0.49