Detailed information NTG0185164

Bioinformatically predicted

Overview

• Name: comE
• Type: Machinery gene
• Locus tag: A9Y60_RS01140
• Genome accession: NZ_CP016016
• Coordinates: 220603..220998 (+)
• Length: 131 a.a.
• NCBI ID: WP_003703428.1
• Uniprot ID: -
• Organism: Neisseria gonorrhoeae strain 34530
• Function: DNA binding (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	213806..228510	220603..220998	within	0

Gene organization within MGE regions

Location: 213806..228510

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A9Y60_RS13800	-	213806..214150 (+)	345	WP_003691787.1	HAD hydrolase family protein	-
A9Y60_RS13805 (A9Y60_01105)	-	214104..214757 (+)	654	Protein_203	TIGR01621 family pseudouridine synthase	-
A9Y60_RS14785	-	220382..220498 (+)	117	Protein_204	competence protein ComE	-
A9Y60_RS01140 (A9Y60_01140)	comE	220603..220998 (+)	396	WP_003703428.1	helix-hairpin-helix domain-containing protein	Machinery gene
A9Y60_RS01145 (A9Y60_01145)	comP	221086..221535 (+)	450	WP_002214937.1	type IV pilin protein	Machinery gene
A9Y60_RS01150 (A9Y60_01150)	-	221912..222058 (-)	147	WP_003691757.1	hypothetical protein	-
A9Y60_RS01155 (A9Y60_01155)	-	222445..223035 (+)	591	WP_080229150.1	DNA cytosine methyltransferase	-
A9Y60_RS01160 (A9Y60_01160)	-	223032..223403 (+)	372	WP_012503918.1	DNA cytosine methyltransferase	-
A9Y60_RS14790	-	223417..224274 (+)	858	WP_012503917.1	ATP-binding protein	-
A9Y60_RS14795	-	224464..225060 (+)	597	WP_012503916.1	TIGR02391 family protein	-
A9Y60_RS01170 (A9Y60_01170)	-	225066..225488 (+)	423	WP_003691751.1	very short patch repair endonuclease	-
A9Y60_RS01175 (A9Y60_01175)	-	225800..226951 (+)	1152	WP_186334060.1	replication initiation factor domain-containing protein	-
A9Y60_RS01180 (A9Y60_01180)	-	226996..227286 (+)	291	WP_002216601.1	hypothetical protein	-
A9Y60_RS01185 (A9Y60_01185)	-	227291..227488 (+)	198	WP_003689600.1	hypothetical protein	-
A9Y60_RS01190 (A9Y60_01190)	-	227562..227780 (+)	219	WP_003691584.1	major capsid protein	-
A9Y60_RS01195 (A9Y60_01195)	-	227787..228065 (+)	279	WP_003689168.1	hypothetical protein	-
A9Y60_RS01200 (A9Y60_01200)	-	228193..228510 (+)	318	WP_003689167.1	DUF1132 family protein	-

Sequence

Protein

• Length: 131 a.a.
• Molecular weight: 13796.61 Da
• Isoelectric Point: 10.8790

>NTDB_id=185164 A9Y60_RS01140 WP_003703428.1 220603..220998(+) (comE) [Neisseria gonorrhoeae strain 34530]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK

Nucleotide

• Length: 396 bp

>NTDB_id=185164 A9Y60_RS01140 WP_003703428.1 220603..220998(+) (comE) [Neisseria gonorrhoeae strain 34530]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (52-110)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1