Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LLJM4_RS11480 | Genome accession | NZ_CP015909 |
| Coordinates | 2226367..2226555 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain JM4 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2221367..2231555
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLJM4_RS11445 (LLJM4_2228) | - | 2222293..2223102 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLJM4_RS11450 (LLJM4_2229) | - | 2223095..2223832 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLJM4_RS11455 (LLJM4_2230) | - | 2224011..2224853 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLJM4_RS11460 (LLJM4_2231) | - | 2224850..2225287 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLJM4_RS11465 (LLJM4_04445) | comGG | 2225367..2225594 (-) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
| LLJM4_RS11470 (LLJM4_2233) | comGF | 2225690..2226115 (-) | 426 | WP_375339262.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLJM4_RS11475 (LLJM4_2234) | comGE | 2226099..2226335 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLJM4_RS11480 (LLJM4_2235) | comGD | 2226367..2226555 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLJM4_RS11485 (LLJM4_2236) | comGC | 2226757..2227134 (-) | 378 | Protein_2238 | competence type IV pilus major pilin ComGC | - |
| LLJM4_RS11490 (LLJM4_2237) | comGB | 2227152..2228177 (-) | 1026 | WP_050574185.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLJM4_RS11495 (LLJM4_2238) | comGA | 2228077..2229057 (-) | 981 | WP_162494683.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=183432 LLJM4_RS11480 WP_014573336.1 2226367..2226555(-) (comGD) [Lactococcus cremoris strain JM4]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=183432 LLJM4_RS11480 WP_014573336.1 2226367..2226555(-) (comGD) [Lactococcus cremoris strain JM4]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |