Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LLJM4_RS11465 Genome accession   NZ_CP015909
Coordinates   2225367..2225594 (-) Length   75 a.a.
NCBI ID   WP_228764408.1    Uniprot ID   -
Organism   Lactococcus cremoris strain JM4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2220367..2230594
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLJM4_RS11440 (LLJM4_04440) - 2220826..2222108 (-) 1283 Protein_2229 IS3 family transposase -
  LLJM4_RS11445 (LLJM4_2228) - 2222293..2223102 (-) 810 WP_011677177.1 metal ABC transporter permease -
  LLJM4_RS11450 (LLJM4_2229) - 2223095..2223832 (-) 738 WP_011677178.1 metal ABC transporter ATP-binding protein -
  LLJM4_RS11455 (LLJM4_2230) - 2224011..2224853 (-) 843 WP_011677179.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  LLJM4_RS11460 (LLJM4_2231) - 2224850..2225287 (-) 438 WP_011677180.1 zinc-dependent MarR family transcriptional regulator -
  LLJM4_RS11465 (LLJM4_04445) comGG 2225367..2225594 (-) 228 WP_228764408.1 competence protein ComGG Machinery gene
  LLJM4_RS11470 (LLJM4_2233) comGF 2225690..2226115 (-) 426 WP_375339262.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLJM4_RS11475 (LLJM4_2234) comGE 2226099..2226335 (-) 237 WP_014573335.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLJM4_RS11480 (LLJM4_2235) comGD 2226367..2226555 (-) 189 WP_014573336.1 hypothetical protein Machinery gene
  LLJM4_RS11485 (LLJM4_2236) comGC 2226757..2227134 (-) 378 Protein_2238 competence type IV pilus major pilin ComGC -
  LLJM4_RS11490 (LLJM4_2237) comGB 2227152..2228177 (-) 1026 WP_050574185.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLJM4_RS11495 (LLJM4_2238) comGA 2228077..2229057 (-) 981 WP_162494683.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 75 a.a.        Molecular weight: 8406.73 Da        Isoelectric Point: 9.0864

>NTDB_id=183429 LLJM4_RS11465 WP_228764408.1 2225367..2225594(-) (comGG) [Lactococcus cremoris strain JM4]
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK

Nucleotide


Download         Length: 228 bp        

>NTDB_id=183429 LLJM4_RS11465 WP_228764408.1 2225367..2225594(-) (comGG) [Lactococcus cremoris strain JM4]
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

96

100

0.96

Multiple sequence alignment