Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LLUC109_RS10525 | Genome accession | NZ_CP015907 |
| Coordinates | 2060437..2060625 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain UC109 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2055437..2065625
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC109_RS10490 (LLUC109_2114) | - | 2056363..2057172 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLUC109_RS10495 (LLUC109_2115) | - | 2057165..2057902 (-) | 738 | WP_015082929.1 | metal ABC transporter ATP-binding protein | - |
| LLUC109_RS10500 (LLUC109_2116) | - | 2058081..2058923 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLUC109_RS10505 (LLUC109_2117) | - | 2058920..2059357 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC109_RS10510 (LLUC109_03085) | comGG | 2059437..2059736 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLUC109_RS10515 (LLUC109_2119) | comGF | 2059760..2060185 (-) | 426 | WP_373467301.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC109_RS10520 (LLUC109_2120) | comGE | 2060169..2060405 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC109_RS10525 (LLUC109_03090) | comGD | 2060437..2060625 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLUC109_RS10530 (LLUC109_2122) | comGC | 2060827..2061177 (-) | 351 | WP_051013201.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLUC109_RS10535 (LLUC109_2123) | comGB | 2061222..2062247 (-) | 1026 | WP_051013189.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLUC109_RS10540 (LLUC109_2124) | comGA | 2062147..2063127 (-) | 981 | WP_015082934.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=183339 LLUC109_RS10525 WP_014573336.1 2060437..2060625(-) (comGD) [Lactococcus cremoris strain UC109]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=183339 LLUC109_RS10525 WP_014573336.1 2060437..2060625(-) (comGD) [Lactococcus cremoris strain UC109]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |