Detailed information NTG0183337

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: LLUC109_RS10515
• Genome accession: NZ_CP015907
• Coordinates: 2059760..2060185 (-)
• Length: 141 a.a.
• NCBI ID: WP_373467301.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain UC109
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2054760..2065185

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC109_RS10490 (LLUC109_2114)	-	2056363..2057172 (-)	810	WP_011677177.1	metal ABC transporter permease	-
LLUC109_RS10495 (LLUC109_2115)	-	2057165..2057902 (-)	738	WP_015082929.1	metal ABC transporter ATP-binding protein	-
LLUC109_RS10500 (LLUC109_2116)	-	2058081..2058923 (-)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLUC109_RS10505 (LLUC109_2117)	-	2058920..2059357 (-)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
LLUC109_RS10510 (LLUC109_03085)	comGG	2059437..2059736 (-)	300	WP_011677181.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUC109_RS10515 (LLUC109_2119)	comGF	2059760..2060185 (-)	426	WP_373467301.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC109_RS10520 (LLUC109_2120)	comGE	2060169..2060405 (-)	237	WP_014573335.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC109_RS10525 (LLUC109_03090)	comGD	2060437..2060625 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLUC109_RS10530 (LLUC109_2122)	comGC	2060827..2061177 (-)	351	WP_051013201.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC109_RS10535 (LLUC109_2123)	comGB	2061222..2062247 (-)	1026	WP_051013189.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUC109_RS10540 (LLUC109_2124)	comGA	2062147..2063127 (-)	981	WP_015082934.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 16268.81 Da
• Isoelectric Point: 7.7759

>NTDB_id=183337 LLUC109_RS10515 WP_373467301.1 2059760..2060185(-) (comGF) [Lactococcus cremoris strain UC109]
MKLKIRAFTLLECLVALLAISGSVLVISGLTRMIEEQMKISQNDSRKDWQIFCEQMRSELSGEKLDNVNQNFLYVTKDKK
LRFGLVGDDFRKSDDKGQGYQPMLYDLKGAKIQAEENLIKITIDFDNGGERVFIYRFTDTK

Nucleotide

• Length: 426 bp

>NTDB_id=183337 LLUC109_RS10515 WP_373467301.1 2059760..2060185(-) (comGF) [Lactococcus cremoris strain UC109]
TTGAAGCTCAAAATTAGGGCATTTACTTTACTTGAATGTCTCGTAGCACTTTTGGCAATTTCTGGTTCAGTGCTAGTCAT
CTCAGGGCTGACTAGAATGATTGAAGAACAGATGAAAATAAGCCAGAATGATAGTAGGAAAGATTGGCAAATATTTTGTG
AACAAATGCGTTCAGAACTCTCCGGAGAAAAATTAGACAATGTGAATCAAAATTTTTTGTATGTGACCAAAGATAAGAAG
TTACGGTTCGGATTAGTAGGGGATGATTTTCGTAAAAGTGATGATAAAGGGCAAGGATACCAACCGATGCTTTATGATTT
AAAAGGAGCAAAAATTCAGGCAGAAGAAAATTTGATAAAAATAACAATTGATTTTGATAATGGAGGTGAGCGAGTATTTA
TTTATCGATTTACTGATACAAAGTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (38-130)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Lactococcus lactis subsp. cremoris KW2	99.291	100	0.993
comYF	Streptococcus mutans UA140	43.972	100	0.44
comYF	Streptococcus mutans UA159	43.262	100	0.433
comGF/cglF	Streptococcus mitis NCTC 12261	39.286	99.291	0.39
comGF/cglF	Streptococcus mitis SK321	39.286	99.291	0.39
comGF/cglF	Streptococcus pneumoniae Rx1	37.857	99.291	0.376
comGF/cglF	Streptococcus pneumoniae D39	37.857	99.291	0.376
comGF/cglF	Streptococcus pneumoniae R6	37.857	99.291	0.376
comGF/cglF	Streptococcus pneumoniae TIGR4	37.857	99.291	0.376