Detailed information
Overview
| Name | comGF | Type | Machinery gene |
| Locus tag | LLUC063_RS11025 | Genome accession | NZ_CP015905 |
| Coordinates | 2169247..2169693 (-) | Length | 148 a.a. |
| NCBI ID | WP_058225890.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain UC063 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2165565..2212709 | 2169247..2169693 | within | 0 |
Gene organization within MGE regions
Location: 2165565..2212709
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC063_RS11005 (LLUC063_2147) | - | 2166478..2167320 (-) | 843 | WP_003129990.1 | metal ABC transporter substrate-binding protein | - |
| LLUC063_RS11010 (LLUC063_2148) | - | 2167317..2167754 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC063_RS11015 (LLUC063_2149) | - | 2167961..2168908 (+) | 948 | WP_003130410.1 | IS30 family transposase | - |
| LLUC063_RS11020 (LLUC063_2150) | comGG | 2168882..2169208 (-) | 327 | WP_058221568.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLUC063_RS11025 (LLUC063_2151) | comGF | 2169247..2169693 (-) | 447 | WP_058225890.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC063_RS11030 (LLUC063_2152) | comGE | 2169656..2169952 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC063_RS11035 (LLUC063_2153) | comGD | 2169924..2170355 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LLUC063_RS11040 (LLUC063_2154) | comGC | 2170315..2170584 (-) | 270 | WP_003129998.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLUC063_RS11045 (LLUC063_2155) | - | 2170758..2171225 (-) | 468 | WP_058225891.1 | hypothetical protein | - |
| LLUC063_RS11050 (LLUC063_2156) | - | 2171308..2171481 (-) | 174 | WP_160321615.1 | hypothetical protein | - |
| LLUC063_RS11055 (LLUC063_2157) | - | 2171568..2172347 (-) | 780 | WP_058225892.1 | peptidoglycan amidohydrolase family protein | - |
| LLUC063_RS11060 (LLUC063_2158) | - | 2172347..2172634 (-) | 288 | WP_023164507.1 | phage holin | - |
| LLUC063_RS11065 (LLUC063_2159) | - | 2172647..2172997 (-) | 351 | WP_058225893.1 | hypothetical protein | - |
| LLUC063_RS11070 (LLUC063_2160) | - | 2173010..2173246 (-) | 237 | WP_081196280.1 | hypothetical protein | - |
| LLUC063_RS11075 (LLUC063_2161) | - | 2173258..2177973 (-) | 4716 | WP_237024113.1 | hypothetical protein | - |
| LLUC063_RS11080 (LLUC063_2162) | - | 2177952..2179481 (-) | 1530 | WP_014570562.1 | distal tail protein Dit | - |
| LLUC063_RS11085 (LLUC063_2163) | - | 2179491..2180552 (-) | 1062 | WP_235589838.1 | hypothetical protein | - |
| LLUC063_RS11090 (LLUC063_2164) | - | 2180619..2181053 (-) | 435 | WP_003131321.1 | minor capsid protein | - |
| LLUC063_RS11095 (LLUC063_2165) | - | 2181053..2181382 (-) | 330 | WP_003131320.1 | hypothetical protein | - |
| LLUC063_RS11100 (LLUC063_2166) | - | 2181379..2181723 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| LLUC063_RS11105 (LLUC063_2167) | - | 2181713..2182114 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| LLUC063_RS11110 (LLUC063_2168) | - | 2182188..2182424 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| LLUC063_RS11115 (LLUC063_2169) | - | 2182453..2183370 (-) | 918 | WP_003131315.1 | hypothetical protein | - |
| LLUC063_RS11120 (LLUC063_2170) | - | 2183385..2184449 (-) | 1065 | WP_058225779.1 | XkdF-like putative serine protease domain-containing protein | - |
| LLUC063_RS11125 (LLUC063_2171) | - | 2184465..2185295 (-) | 831 | WP_014570553.1 | phage minor head protein | - |
| LLUC063_RS11130 (LLUC063_2172) | - | 2185288..2186817 (-) | 1530 | WP_058225778.1 | phage portal protein | - |
| LLUC063_RS11135 (LLUC063_2173) | terL | 2186830..2188272 (-) | 1443 | WP_152023954.1 | phage terminase large subunit | - |
| LLUC063_RS11140 (LLUC063_02960) | - | 2188262..2188453 (-) | 192 | Protein_2165 | helix-turn-helix domain-containing protein | - |
| LLUC063_RS13090 (LLUC063_02965) | - | 2188604..2188810 (-) | 207 | Protein_2166 | HNH endonuclease | - |
| LLUC063_RS13095 | - | 2188814..2189071 (-) | 258 | Protein_2167 | transposase | - |
| LLUC063_RS11150 (LLUC063_2175) | - | 2189243..2189632 (-) | 390 | WP_023164630.1 | DUF722 domain-containing protein | - |
| LLUC063_RS11155 (LLUC063_2178) | - | 2190136..2190354 (-) | 219 | WP_058225572.1 | hypothetical protein | - |
| LLUC063_RS11160 (LLUC063_2179) | - | 2190351..2190533 (-) | 183 | WP_058225573.1 | hypothetical protein | - |
| LLUC063_RS11165 (LLUC063_2181) | - | 2190714..2190914 (-) | 201 | WP_058225688.1 | DUF1660 domain-containing protein | - |
| LLUC063_RS11170 (LLUC063_2182) | - | 2190911..2191153 (-) | 243 | WP_014570545.1 | hypothetical protein | - |
| LLUC063_RS11175 (LLUC063_2183) | - | 2191200..2191892 (-) | 693 | WP_081196281.1 | hypothetical protein | - |
| LLUC063_RS11180 (LLUC063_2184) | - | 2191919..2192272 (-) | 354 | WP_081196282.1 | hypothetical protein | - |
| LLUC063_RS11185 (LLUC063_2185) | - | 2192275..2192694 (-) | 420 | WP_081196283.1 | dUTP diphosphatase | - |
| LLUC063_RS11190 (LLUC063_2186) | - | 2192691..2193002 (-) | 312 | WP_058225823.1 | hypothetical protein | - |
| LLUC063_RS11195 (LLUC063_2187) | - | 2192999..2193565 (-) | 567 | WP_058225822.1 | DUF1642 domain-containing protein | - |
| LLUC063_RS11200 (LLUC063_2188) | - | 2193581..2193832 (-) | 252 | WP_023188825.1 | hypothetical protein | - |
| LLUC063_RS11205 (LLUC063_2189) | - | 2193844..2194119 (-) | 276 | WP_014570536.1 | hypothetical protein | - |
| LLUC063_RS11210 (LLUC063_2190) | - | 2194128..2194334 (-) | 207 | WP_014570535.1 | hypothetical protein | - |
| LLUC063_RS11215 (LLUC063_2191) | - | 2194445..2194684 (-) | 240 | WP_058225578.1 | DUF1031 family protein | - |
| LLUC063_RS11220 (LLUC063_2192) | - | 2194681..2194986 (-) | 306 | WP_058225577.1 | hypothetical protein | - |
| LLUC063_RS11225 (LLUC063_2193) | - | 2194991..2195380 (-) | 390 | WP_081196284.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLUC063_RS11230 (LLUC063_2194) | - | 2195393..2195635 (-) | 243 | WP_014570811.1 | L-rhamnose isomerase | - |
| LLUC063_RS11235 (LLUC063_2195) | - | 2195628..2196530 (-) | 903 | WP_058225991.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LLUC063_RS11240 (LLUC063_2196) | - | 2196810..2197736 (-) | 927 | WP_058225990.1 | RecT family recombinase | - |
| LLUC063_RS11245 (LLUC063_2197) | - | 2197733..2198566 (-) | 834 | WP_058225989.1 | hypothetical protein | - |
| LLUC063_RS11250 (LLUC063_2198) | - | 2198669..2198911 (-) | 243 | WP_058225988.1 | hypothetical protein | - |
| LLUC063_RS11255 (LLUC063_2199) | - | 2198924..2199046 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| LLUC063_RS11260 (LLUC063_2200) | - | 2199043..2199225 (-) | 183 | WP_003130605.1 | hypothetical protein | - |
| LLUC063_RS11265 (LLUC063_2201) | - | 2199241..2199954 (-) | 714 | WP_081042558.1 | antA/AntB antirepressor family protein | - |
| LLUC063_RS11270 (LLUC063_2202) | - | 2200010..2200219 (-) | 210 | WP_023164648.1 | helix-turn-helix transcriptional regulator | - |
| LLUC063_RS11275 (LLUC063_2203) | - | 2200412..2200837 (+) | 426 | WP_201013557.1 | XRE family transcriptional regulator | - |
| LLUC063_RS11280 (LLUC063_2204) | - | 2200848..2201432 (+) | 585 | WP_058225987.1 | hypothetical protein | - |
| LLUC063_RS11285 (LLUC063_2205) | - | 2201491..2201784 (+) | 294 | WP_058225986.1 | hypothetical protein | - |
| LLUC063_RS11290 (LLUC063_2206) | - | 2201929..2203386 (+) | 1458 | WP_058225993.1 | recombinase family protein | - |
| LLUC063_RS11295 (LLUC063_02970) | - | 2203383..2203523 (-) | 141 | WP_023164653.1 | hypothetical protein | - |
| LLUC063_RS11300 (LLUC063_02975) | comGB | 2203537..2204115 (-) | 579 | WP_235589859.1 | type II secretion system F family protein | Machinery gene |
| LLUC063_RS11305 (LLUC063_2208) | istB | 2204198..2204956 (-) | 759 | WP_003331414.1 | IS21-like element IS712 family helper ATPase IstB | - |
| LLUC063_RS11310 (LLUC063_2209) | istA | 2204968..2206191 (-) | 1224 | WP_003331415.1 | IS21-like element IS712 family transposase | - |
| LLUC063_RS11315 (LLUC063_02980) | comGB | 2206267..2206725 (-) | 459 | WP_327063280.1 | type II secretion system F family protein | Machinery gene |
| LLUC063_RS11320 (LLUC063_2210) | comGA | 2206673..2207612 (-) | 940 | Protein_2202 | competence type IV pilus ATPase ComGA | - |
| LLUC063_RS11325 (LLUC063_2211) | - | 2207732..2212648 (-) | 4917 | WP_058221721.1 | PolC-type DNA polymerase III | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 17141.93 Da Isoelectric Point: 8.6780
>NTDB_id=183239 LLUC063_RS11025 WP_058225890.1 2169247..2169693(-) (comGF) [Lactococcus lactis subsp. lactis strain UC063]
MERKLCDLNFKVKAFTLLECLVALLAISGSVLVISGLTKMLKEQVAISQSDSIKDWQIFCQQMRFELSGTKLDRVEQNFL
YVTKDKKLRFGFMSDDFRKTDDKGQSYQPMLYDIKAAKIQATKNLITIRIDFNQGGERTFIYQFPEDT
MERKLCDLNFKVKAFTLLECLVALLAISGSVLVISGLTKMLKEQVAISQSDSIKDWQIFCQQMRFELSGTKLDRVEQNFL
YVTKDKKLRFGFMSDDFRKTDDKGQSYQPMLYDIKAAKIQATKNLITIRIDFNQGGERTFIYQFPEDT
Nucleotide
Download Length: 447 bp
>NTDB_id=183239 LLUC063_RS11025 WP_058225890.1 2169247..2169693(-) (comGF) [Lactococcus lactis subsp. lactis strain UC063]
ATGGAAAGGAAATTATGCGACTTGAACTTCAAAGTTAAAGCATTTACCTTGTTGGAGTGTTTGGTGGCACTTCTTGCAAT
TTCTGGTTCAGTCCTTGTCATCTCAGGTTTAACAAAGATGTTGAAAGAACAAGTGGCGATTAGTCAAAGTGATAGCATAA
AAGATTGGCAAATTTTCTGTCAGCAAATGCGTTTTGAACTCTCAGGAACAAAATTAGATAGGGTAGAACAGAATTTTCTG
TATGTAACTAAAGATAAAAAACTAAGGTTTGGTTTTATGAGTGATGATTTCCGGAAGACTGATGACAAAGGTCAGAGTTA
TCAGCCAATGCTTTATGATATAAAAGCGGCTAAGATTCAAGCTACTAAAAATTTAATAACCATAAGAATTGATTTTAATC
AAGGAGGTGAAAGAACATTTATTTATCAATTTCCAGAAGATACGTAA
ATGGAAAGGAAATTATGCGACTTGAACTTCAAAGTTAAAGCATTTACCTTGTTGGAGTGTTTGGTGGCACTTCTTGCAAT
TTCTGGTTCAGTCCTTGTCATCTCAGGTTTAACAAAGATGTTGAAAGAACAAGTGGCGATTAGTCAAAGTGATAGCATAA
AAGATTGGCAAATTTTCTGTCAGCAAATGCGTTTTGAACTCTCAGGAACAAAATTAGATAGGGTAGAACAGAATTTTCTG
TATGTAACTAAAGATAAAAAACTAAGGTTTGGTTTTATGAGTGATGATTTCCGGAAGACTGATGACAAAGGTCAGAGTTA
TCAGCCAATGCTTTATGATATAAAAGCGGCTAAGATTCAAGCTACTAAAAATTTAATAACCATAAGAATTGATTTTAATC
AAGGAGGTGAAAGAACATTTATTTATCAATTTCCAGAAGATACGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGF | Lactococcus lactis subsp. cremoris KW2 |
75.54 |
93.919 |
0.709 |
| comYF | Streptococcus mutans UA140 |
47.518 |
95.27 |
0.453 |
| comYF | Streptococcus mutans UA159 |
46.809 |
95.27 |
0.446 |
| comGF/cglF | Streptococcus mitis SK321 |
42.336 |
92.568 |
0.392 |
| comGF/cglF | Streptococcus mitis NCTC 12261 |
40.876 |
92.568 |
0.378 |
| comGF/cglF | Streptococcus pneumoniae Rx1 |
39.716 |
95.27 |
0.378 |
| comGF/cglF | Streptococcus pneumoniae D39 |
39.716 |
95.27 |
0.378 |
| comGF/cglF | Streptococcus pneumoniae R6 |
39.716 |
95.27 |
0.378 |
| comGF/cglF | Streptococcus pneumoniae TIGR4 |
39.716 |
95.27 |
0.378 |