Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLUC063_RS11020 Genome accession   NZ_CP015905
Coordinates   2168882..2169208 (-) Length   108 a.a.
NCBI ID   WP_058221568.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain UC063     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2165565..2212709 2168882..2169208 within 0


Gene organization within MGE regions


Location: 2165565..2212709
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUC063_RS11005 (LLUC063_2147) - 2166478..2167320 (-) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  LLUC063_RS11010 (LLUC063_2148) - 2167317..2167754 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  LLUC063_RS11015 (LLUC063_2149) - 2167961..2168908 (+) 948 WP_003130410.1 IS30 family transposase -
  LLUC063_RS11020 (LLUC063_2150) comGG 2168882..2169208 (-) 327 WP_058221568.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUC063_RS11025 (LLUC063_2151) comGF 2169247..2169693 (-) 447 WP_058225890.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUC063_RS11030 (LLUC063_2152) comGE 2169656..2169952 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUC063_RS11035 (LLUC063_2153) comGD 2169924..2170355 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLUC063_RS11040 (LLUC063_2154) comGC 2170315..2170584 (-) 270 WP_003129998.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUC063_RS11045 (LLUC063_2155) - 2170758..2171225 (-) 468 WP_058225891.1 hypothetical protein -
  LLUC063_RS11050 (LLUC063_2156) - 2171308..2171481 (-) 174 WP_160321615.1 hypothetical protein -
  LLUC063_RS11055 (LLUC063_2157) - 2171568..2172347 (-) 780 WP_058225892.1 peptidoglycan amidohydrolase family protein -
  LLUC063_RS11060 (LLUC063_2158) - 2172347..2172634 (-) 288 WP_023164507.1 phage holin -
  LLUC063_RS11065 (LLUC063_2159) - 2172647..2172997 (-) 351 WP_058225893.1 hypothetical protein -
  LLUC063_RS11070 (LLUC063_2160) - 2173010..2173246 (-) 237 WP_081196280.1 hypothetical protein -
  LLUC063_RS11075 (LLUC063_2161) - 2173258..2177973 (-) 4716 WP_237024113.1 hypothetical protein -
  LLUC063_RS11080 (LLUC063_2162) - 2177952..2179481 (-) 1530 WP_014570562.1 distal tail protein Dit -
  LLUC063_RS11085 (LLUC063_2163) - 2179491..2180552 (-) 1062 WP_235589838.1 hypothetical protein -
  LLUC063_RS11090 (LLUC063_2164) - 2180619..2181053 (-) 435 WP_003131321.1 minor capsid protein -
  LLUC063_RS11095 (LLUC063_2165) - 2181053..2181382 (-) 330 WP_003131320.1 hypothetical protein -
  LLUC063_RS11100 (LLUC063_2166) - 2181379..2181723 (-) 345 WP_014570557.1 putative minor capsid protein -
  LLUC063_RS11105 (LLUC063_2167) - 2181713..2182114 (-) 402 WP_014570556.1 hypothetical protein -
  LLUC063_RS11110 (LLUC063_2168) - 2182188..2182424 (-) 237 WP_014570555.1 Ig-like domain-containing protein -
  LLUC063_RS11115 (LLUC063_2169) - 2182453..2183370 (-) 918 WP_003131315.1 hypothetical protein -
  LLUC063_RS11120 (LLUC063_2170) - 2183385..2184449 (-) 1065 WP_058225779.1 XkdF-like putative serine protease domain-containing protein -
  LLUC063_RS11125 (LLUC063_2171) - 2184465..2185295 (-) 831 WP_014570553.1 phage minor head protein -
  LLUC063_RS11130 (LLUC063_2172) - 2185288..2186817 (-) 1530 WP_058225778.1 phage portal protein -
  LLUC063_RS11135 (LLUC063_2173) terL 2186830..2188272 (-) 1443 WP_152023954.1 phage terminase large subunit -
  LLUC063_RS11140 (LLUC063_02960) - 2188262..2188453 (-) 192 Protein_2165 helix-turn-helix domain-containing protein -
  LLUC063_RS13090 (LLUC063_02965) - 2188604..2188810 (-) 207 Protein_2166 HNH endonuclease -
  LLUC063_RS13095 - 2188814..2189071 (-) 258 Protein_2167 transposase -
  LLUC063_RS11150 (LLUC063_2175) - 2189243..2189632 (-) 390 WP_023164630.1 DUF722 domain-containing protein -
  LLUC063_RS11155 (LLUC063_2178) - 2190136..2190354 (-) 219 WP_058225572.1 hypothetical protein -
  LLUC063_RS11160 (LLUC063_2179) - 2190351..2190533 (-) 183 WP_058225573.1 hypothetical protein -
  LLUC063_RS11165 (LLUC063_2181) - 2190714..2190914 (-) 201 WP_058225688.1 DUF1660 domain-containing protein -
  LLUC063_RS11170 (LLUC063_2182) - 2190911..2191153 (-) 243 WP_014570545.1 hypothetical protein -
  LLUC063_RS11175 (LLUC063_2183) - 2191200..2191892 (-) 693 WP_081196281.1 hypothetical protein -
  LLUC063_RS11180 (LLUC063_2184) - 2191919..2192272 (-) 354 WP_081196282.1 hypothetical protein -
  LLUC063_RS11185 (LLUC063_2185) - 2192275..2192694 (-) 420 WP_081196283.1 dUTP diphosphatase -
  LLUC063_RS11190 (LLUC063_2186) - 2192691..2193002 (-) 312 WP_058225823.1 hypothetical protein -
  LLUC063_RS11195 (LLUC063_2187) - 2192999..2193565 (-) 567 WP_058225822.1 DUF1642 domain-containing protein -
  LLUC063_RS11200 (LLUC063_2188) - 2193581..2193832 (-) 252 WP_023188825.1 hypothetical protein -
  LLUC063_RS11205 (LLUC063_2189) - 2193844..2194119 (-) 276 WP_014570536.1 hypothetical protein -
  LLUC063_RS11210 (LLUC063_2190) - 2194128..2194334 (-) 207 WP_014570535.1 hypothetical protein -
  LLUC063_RS11215 (LLUC063_2191) - 2194445..2194684 (-) 240 WP_058225578.1 DUF1031 family protein -
  LLUC063_RS11220 (LLUC063_2192) - 2194681..2194986 (-) 306 WP_058225577.1 hypothetical protein -
  LLUC063_RS11225 (LLUC063_2193) - 2194991..2195380 (-) 390 WP_081196284.1 RusA family crossover junction endodeoxyribonuclease -
  LLUC063_RS11230 (LLUC063_2194) - 2195393..2195635 (-) 243 WP_014570811.1 L-rhamnose isomerase -
  LLUC063_RS11235 (LLUC063_2195) - 2195628..2196530 (-) 903 WP_058225991.1 phage replisome organizer N-terminal domain-containing protein -
  LLUC063_RS11240 (LLUC063_2196) - 2196810..2197736 (-) 927 WP_058225990.1 RecT family recombinase -
  LLUC063_RS11245 (LLUC063_2197) - 2197733..2198566 (-) 834 WP_058225989.1 hypothetical protein -
  LLUC063_RS11250 (LLUC063_2198) - 2198669..2198911 (-) 243 WP_058225988.1 hypothetical protein -
  LLUC063_RS11255 (LLUC063_2199) - 2198924..2199046 (-) 123 WP_023164646.1 hypothetical protein -
  LLUC063_RS11260 (LLUC063_2200) - 2199043..2199225 (-) 183 WP_003130605.1 hypothetical protein -
  LLUC063_RS11265 (LLUC063_2201) - 2199241..2199954 (-) 714 WP_081042558.1 antA/AntB antirepressor family protein -
  LLUC063_RS11270 (LLUC063_2202) - 2200010..2200219 (-) 210 WP_023164648.1 helix-turn-helix transcriptional regulator -
  LLUC063_RS11275 (LLUC063_2203) - 2200412..2200837 (+) 426 WP_201013557.1 XRE family transcriptional regulator -
  LLUC063_RS11280 (LLUC063_2204) - 2200848..2201432 (+) 585 WP_058225987.1 hypothetical protein -
  LLUC063_RS11285 (LLUC063_2205) - 2201491..2201784 (+) 294 WP_058225986.1 hypothetical protein -
  LLUC063_RS11290 (LLUC063_2206) - 2201929..2203386 (+) 1458 WP_058225993.1 recombinase family protein -
  LLUC063_RS11295 (LLUC063_02970) - 2203383..2203523 (-) 141 WP_023164653.1 hypothetical protein -
  LLUC063_RS11300 (LLUC063_02975) comGB 2203537..2204115 (-) 579 WP_235589859.1 type II secretion system F family protein Machinery gene
  LLUC063_RS11305 (LLUC063_2208) istB 2204198..2204956 (-) 759 WP_003331414.1 IS21-like element IS712 family helper ATPase IstB -
  LLUC063_RS11310 (LLUC063_2209) istA 2204968..2206191 (-) 1224 WP_003331415.1 IS21-like element IS712 family transposase -
  LLUC063_RS11315 (LLUC063_02980) comGB 2206267..2206725 (-) 459 WP_327063280.1 type II secretion system F family protein Machinery gene
  LLUC063_RS11320 (LLUC063_2210) comGA 2206673..2207612 (-) 940 Protein_2202 competence type IV pilus ATPase ComGA -
  LLUC063_RS11325 (LLUC063_2211) - 2207732..2212648 (-) 4917 WP_058221721.1 PolC-type DNA polymerase III -

Sequence


Protein


Download         Length: 108 a.a.        Molecular weight: 12234.69 Da        Isoelectric Point: 6.0669

>NTDB_id=183238 LLUC063_RS11020 WP_058221568.1 2168882..2169208(-) (comGG) [Lactococcus lactis subsp. lactis strain UC063]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKNANCKSKLASQAHLI

Nucleotide


Download         Length: 327 bp        

>NTDB_id=183238 LLUC063_RS11020 WP_058221568.1 2168882..2169208(-) (comGG) [Lactococcus lactis subsp. lactis strain UC063]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAACGCAAATTGCAAGTCCAAGTTAGCCAGCCAAGCTCATCT
CATATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.065

86.111

0.5


Multiple sequence alignment