Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGA   Type   Machinery gene
Locus tag   LLJM3_RS11805 Genome accession   NZ_CP015901
Coordinates   2265693..2265884 (-) Length   63 a.a.
NCBI ID   WP_041167484.1    Uniprot ID   A0AA47LWC5
Organism   Lactococcus cremoris strain JM3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2260693..2270884
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLJM3_RS11765 (LLJM3_03405) comGG 2261186..2261485 (-) 300 WP_011677181.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLJM3_RS11770 (LLJM3_2408) comGF 2261509..2261934 (-) 426 WP_011677182.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLJM3_RS11775 (LLJM3_2409) comGE 2261918..2262214 (-) 297 WP_011677183.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLJM3_RS11780 (LLJM3_2410) comGD 2262186..2262374 (-) 189 WP_014573336.1 hypothetical protein Machinery gene
  LLJM3_RS11785 (LLJM3_2411) comGC 2262576..2262926 (-) 351 WP_050574401.1 competence type IV pilus major pilin ComGC Machinery gene
  LLJM3_RS11790 (LLJM3_2412) comGB 2262971..2263997 (-) 1027 Protein_2295 competence type IV pilus assembly protein ComGB -
  LLJM3_RS11795 (LLJM3_03410) - 2263897..2264718 (-) 822 Protein_2296 ATPase, T2SS/T4P/T4SS family -
  LLJM3_RS11800 (LLJM3_2414) - 2264821..2265711 (+) 891 WP_011677100.1 IS982 family transposase -
  LLJM3_RS11805 (LLJM3_03415) comGA 2265693..2265884 (-) 192 WP_041167484.1 hypothetical protein Machinery gene
  LLJM3_RS11810 (LLJM3_2415) - 2265999..2269829 (-) 3831 Protein_2299 PolC-type DNA polymerase III -

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7241.49 Da        Isoelectric Point: 4.3901

>NTDB_id=183047 LLJM3_RS11805 WP_041167484.1 2265693..2265884(-) (comGA) [Lactococcus cremoris strain JM3]
MVQKKAQELIQKAIEMEASDIYLIASGNLYKIYIRQQLGRTLIEELNQEIGLPELLVDYLGMT

Nucleotide


Download         Length: 192 bp        

>NTDB_id=183047 LLJM3_RS11805 WP_041167484.1 2265693..2265884(-) (comGA) [Lactococcus cremoris strain JM3]
ATGGTACAGAAAAAAGCACAAGAACTCATTCAAAAGGCAATTGAGATGGAGGCTTCTGATATTTATTTAATTGCTTCAGG
AAATCTTTATAAGATATATATTCGTCAACAATTAGGGCGAACTTTAATAGAGGAACTTAACCAAGAGATTGGTTTACCCG
AATTGCTAGTTGATTATTTAGGCATGACTTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGA Lactococcus lactis subsp. cremoris KW2

96.226

84.127

0.81

Multiple sequence alignment