Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LLJM1_RS00785 Genome accession   NZ_CP015899
Coordinates   152116..152343 (+) Length   75 a.a.
NCBI ID   WP_228764408.1    Uniprot ID   -
Organism   Lactococcus cremoris strain JM1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 152226..164727 152116..152343 flank -117


Gene organization within MGE regions


Location: 152116..164727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLJM1_RS00785 (LLJM1_02515) comGG 152116..152343 (+) 228 WP_228764408.1 competence protein ComGG Machinery gene
  LLJM1_RS00790 (LLJM1_0141) - 152423..152860 (+) 438 WP_011677180.1 zinc-dependent MarR family transcriptional regulator -
  LLJM1_RS00795 (LLJM1_0142) - 152857..153699 (+) 843 WP_011677179.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  LLJM1_RS00800 (LLJM1_0143) - 153878..154615 (+) 738 WP_011677178.1 metal ABC transporter ATP-binding protein -
  LLJM1_RS00805 (LLJM1_0144) - 154608..155417 (+) 810 WP_011677177.1 metal ABC transporter permease -
  LLJM1_RS00810 (LLJM1_02520) - 155490..156883 (+) 1394 WP_133265029.1 IS3 family transposase -
  LLJM1_RS00815 (LLJM1_0147) - 156947..157819 (-) 873 WP_032951293.1 RluA family pseudouridine synthase -
  LLJM1_RS00820 (LLJM1_02525) - 158013..158390 (+) 378 Protein_152 pyridoxamine 5'-phosphate oxidase family protein -
  LLJM1_RS00825 (LLJM1_0149) - 158505..158936 (+) 432 WP_011677172.1 DUF3290 domain-containing protein -
  LLJM1_RS00830 (LLJM1_0150) - 158954..159589 (+) 636 WP_011677171.1 DUF421 domain-containing protein -
  LLJM1_RS00835 (LLJM1_0151) - 159976..162207 (+) 2232 WP_081196045.1 PBP1A family penicillin-binding protein -
  LLJM1_RS00840 (LLJM1_0152) - 162309..164126 (+) 1818 WP_063280762.1 acyltransferase family protein -
  LLJM1_RS00845 (LLJM1_0153) rpmG 164167..164316 (+) 150 WP_011677168.1 50S ribosomal protein L33 -
  LLJM1_RS00850 (LLJM1_0154) secE 164397..164591 (+) 195 WP_011677167.1 preprotein translocase subunit SecE -

Sequence

Protein


Download         Length: 75 a.a.        Molecular weight: 8406.73 Da        Isoelectric Point: 9.0864

>NTDB_id=182916 LLJM1_RS00785 WP_228764408.1 152116..152343(+) (comGG) [Lactococcus cremoris strain JM1]
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK

Nucleotide


Download         Length: 228 bp        

>NTDB_id=182916 LLJM1_RS00785 WP_228764408.1 152116..152343(+) (comGG) [Lactococcus cremoris strain JM1]
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

96

100

0.96

Multiple sequence alignment