Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLJM1_RS00785 Genome accession   NZ_CP015899
Coordinates   152116..152343 (+) Length   75 a.a.
NCBI ID   WP_228764408.1    Uniprot ID   -
Organism   Lactococcus cremoris strain JM1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 147116..157343
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLJM1_RS00755 (LLJM1_0134) comGA 148653..149633 (+) 981 WP_032951299.1 competence type IV pilus ATPase ComGA Machinery gene
  LLJM1_RS00760 (LLJM1_0135) comGB 149533..150558 (+) 1026 WP_050595614.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLJM1_RS00765 (LLJM1_0136) comGC 150603..150953 (+) 351 WP_050574187.1 competence type IV pilus major pilin ComGC Machinery gene
  LLJM1_RS00770 (LLJM1_0137) comGD 151155..151343 (+) 189 WP_014573336.1 hypothetical protein Machinery gene
  LLJM1_RS00775 (LLJM1_0138) comGE 151375..151611 (+) 237 WP_014573335.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLJM1_RS00780 (LLJM1_0139) comGF 151574..152020 (+) 447 WP_011836043.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLJM1_RS00785 (LLJM1_02515) comGG 152116..152343 (+) 228 WP_228764408.1 competence protein ComGG Machinery gene
  LLJM1_RS00790 (LLJM1_0141) - 152423..152860 (+) 438 WP_011677180.1 zinc-dependent MarR family transcriptional regulator -
  LLJM1_RS00795 (LLJM1_0142) - 152857..153699 (+) 843 WP_011677179.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  LLJM1_RS00800 (LLJM1_0143) - 153878..154615 (+) 738 WP_011677178.1 metal ABC transporter ATP-binding protein -
  LLJM1_RS00805 (LLJM1_0144) - 154608..155417 (+) 810 WP_011677177.1 metal ABC transporter permease -
  LLJM1_RS00810 (LLJM1_02520) - 155490..156883 (+) 1394 WP_133265029.1 IS3 family transposase -

Sequence


Protein


Download         Length: 75 a.a.        Molecular weight: 8406.73 Da        Isoelectric Point: 9.0864

>NTDB_id=182916 LLJM1_RS00785 WP_228764408.1 152116..152343(+) (comGG) [Lactococcus cremoris strain JM1]
MKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSNKTYCFDVRLKDGRIYQIVK

Nucleotide


Download         Length: 228 bp        

>NTDB_id=182916 LLJM1_RS00785 WP_228764408.1 152116..152343(+) (comGG) [Lactococcus cremoris strain JM1]
TTGAAAATAGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCA
ACTTAATTTTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTG
TTAGTAATAAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTATCAAATAGTAAAGTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

96

100

0.96


Multiple sequence alignment