Detailed information NTG0182913

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: LLJM1_RS00770
• Genome accession: NZ_CP015899
• Coordinates: 151155..151343 (+)
• Length: 62 a.a.
• NCBI ID: WP_014573336.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain JM1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	152226..164727	151155..151343	flank	883

Gene organization within MGE regions

Location: 151155..164727

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLJM1_RS00770 (LLJM1_0137)	comGD	151155..151343 (+)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLJM1_RS00775 (LLJM1_0138)	comGE	151375..151611 (+)	237	WP_014573335.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLJM1_RS00780 (LLJM1_0139)	comGF	151574..152020 (+)	447	WP_011836043.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLJM1_RS00785 (LLJM1_02515)	comGG	152116..152343 (+)	228	WP_228764408.1	competence protein ComGG	Machinery gene
LLJM1_RS00790 (LLJM1_0141)	-	152423..152860 (+)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
LLJM1_RS00795 (LLJM1_0142)	-	152857..153699 (+)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLJM1_RS00800 (LLJM1_0143)	-	153878..154615 (+)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LLJM1_RS00805 (LLJM1_0144)	-	154608..155417 (+)	810	WP_011677177.1	metal ABC transporter permease	-
LLJM1_RS00810 (LLJM1_02520)	-	155490..156883 (+)	1394	WP_133265029.1	IS3 family transposase	-
LLJM1_RS00815 (LLJM1_0147)	-	156947..157819 (-)	873	WP_032951293.1	RluA family pseudouridine synthase	-
LLJM1_RS00820 (LLJM1_02525)	-	158013..158390 (+)	378	Protein_152	pyridoxamine 5'-phosphate oxidase family protein	-
LLJM1_RS00825 (LLJM1_0149)	-	158505..158936 (+)	432	WP_011677172.1	DUF3290 domain-containing protein	-
LLJM1_RS00830 (LLJM1_0150)	-	158954..159589 (+)	636	WP_011677171.1	DUF421 domain-containing protein	-
LLJM1_RS00835 (LLJM1_0151)	-	159976..162207 (+)	2232	WP_081196045.1	PBP1A family penicillin-binding protein	-
LLJM1_RS00840 (LLJM1_0152)	-	162309..164126 (+)	1818	WP_063280762.1	acyltransferase family protein	-
LLJM1_RS00845 (LLJM1_0153)	rpmG	164167..164316 (+)	150	WP_011677168.1	50S ribosomal protein L33	-
LLJM1_RS00850 (LLJM1_0154)	secE	164397..164591 (+)	195	WP_011677167.1	preprotein translocase subunit SecE	-

Sequence

Protein

• Length: 62 a.a.
• Molecular weight: 7336.65 Da
• Isoelectric Point: 8.3463

>NTDB_id=182913 LLJM1_RS00770 WP_014573336.1 151155..151343(+) (comGD) [Lactococcus cremoris strain JM1]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN

Nucleotide

• Length: 189 bp

>NTDB_id=182913 LLJM1_RS00770 WP_014573336.1 151155..151343(+) (comGD) [Lactococcus cremoris strain JM1]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Lactococcus lactis subsp. cremoris KW2	93.548	100	0.935
comYD	Streptococcus mutans UA140	43.396	85.484	0.371
comYD	Streptococcus mutans UA159	43.396	85.484	0.371