Detailed information
Bioinformatically predicted
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LL158_RS10565 | Genome accession | NZ_CP015894 |
| Coordinates | 2074722..2074910 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain 158 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2069722..2079910
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL158_RS10530 (LL158_03375) | - | 2070648..2071457 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LL158_RS10535 (LL158_03380) | - | 2071450..2072187 (-) | 738 | WP_015082929.1 | metal ABC transporter ATP-binding protein | - |
| LL158_RS10540 (LL158_03385) | - | 2072366..2073208 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LL158_RS10545 (LL158_03390) | - | 2073205..2073642 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LL158_RS10550 (LL158_03395) | comGG | 2073722..2074021 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LL158_RS10555 (LL158_03400) | comGF | 2074045..2074470 (-) | 426 | WP_373467301.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LL158_RS10560 (LL158_03405) | comGE | 2074454..2074690 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LL158_RS10565 (LL158_03410) | comGD | 2074722..2074910 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LL158_RS10570 (LL158_2041) | comGC | 2075112..2075462 (-) | 351 | WP_051013201.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LL158_RS10575 (LL158_2042) | comGB | 2075507..2076532 (-) | 1026 | WP_051013189.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LL158_RS10580 (LL158_2043) | comGA | 2076432..2077412 (-) | 981 | WP_015082934.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=182851 LL158_RS10565 WP_014573336.1 2074722..2074910(-) (comGD) [Lactococcus cremoris strain 158]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=182851 LL158_RS10565 WP_014573336.1 2074722..2074910(-) (comGD) [Lactococcus cremoris strain 158]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |