Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   A4209_RS01990 Genome accession   NZ_CP015572
Coordinates   392530..393030 (-) Length   166 a.a.
NCBI ID   WP_005719438.1    Uniprot ID   A0A9X3URY5
Organism   Pasteurella multocida strain USDA-ARS-USMARC-60381     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 338132..399890 392530..393030 within 0
IS/Tn 391883..392347 392530..393030 flank 183


Gene organization within MGE regions


Location: 338132..399890
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A4209_RS01595 (A4209_01595) tnpA 338132..338548 (-) 417 WP_005720092.1 IS200/IS605 family transposase -
  A4209_RS01600 (A4209_01600) - 338595..339731 (+) 1137 WP_064775610.1 RNA-guided endonuclease InsQ/TnpB family protein -
  A4209_RS01605 (A4209_01605) - 339871..340197 (-) 327 WP_064775609.1 hypothetical protein -
  A4209_RS01610 (A4209_01610) - 340245..346139 (-) 5895 WP_081317749.1 phage tail protein -
  A4209_RS01615 (A4209_01615) - 346143..346733 (-) 591 WP_042743292.1 tail assembly protein -
  A4209_RS01620 (A4209_01620) - 346676..347416 (-) 741 WP_064775658.1 C40 family peptidase -
  A4209_RS01625 (A4209_01625) - 347419..348123 (-) 705 WP_064775657.1 phage minor tail protein L -
  A4209_RS11245 (A4209_01630) - 348120..350834 (-) 2715 WP_064775656.1 tape measure protein -
  A4209_RS01640 (A4209_01635) - 350957..351652 (-) 696 WP_064775655.1 hypothetical protein -
  A4209_RS01645 (A4209_01640) - 351957..352310 (-) 354 WP_231140379.1 phage tail protein -
  A4209_RS01655 (A4209_01650) - 352656..353072 (-) 417 WP_016533103.1 hypothetical protein -
  A4209_RS01660 (A4209_01655) - 353145..354161 (-) 1017 WP_016533104.1 phage tail tube protein -
  A4209_RS01665 (A4209_01660) - 354174..354566 (-) 393 WP_015691079.1 phage tail terminator-like protein -
  A4209_RS01670 (A4209_01665) - 354566..354967 (-) 402 WP_015691078.1 HK97 gp10 family phage protein -
  A4209_RS01675 (A4209_01670) - 354969..355343 (-) 375 WP_015691077.1 hypothetical protein -
  A4209_RS01680 (A4209_01675) - 355345..355812 (-) 468 WP_015691076.1 DnaT-like ssDNA-binding protein -
  A4209_RS01685 (A4209_01680) - 355829..356065 (-) 237 WP_015691075.1 HeH/LEM domain-containing protein -
  A4209_RS01690 (A4209_01685) - 356122..357279 (-) 1158 WP_015691074.1 P22 phage major capsid protein family protein -
  A4209_RS01695 (A4209_01690) - 357297..358067 (-) 771 WP_015691073.1 hypothetical protein -
  A4209_RS11180 - 358196..358363 (-) 168 WP_015691072.1 hypothetical protein -
  A4209_RS01700 (A4209_01695) - 358403..358837 (-) 435 WP_015691071.1 HD domain-containing protein -
  A4209_RS01705 (A4209_01700) - 358812..359030 (-) 219 WP_015691070.1 hypothetical protein -
  A4209_RS01710 (A4209_01705) - 359033..360646 (-) 1614 WP_231140380.1 minor capsid protein -
  A4209_RS01715 (A4209_01710) - 360624..362027 (-) 1404 WP_064775653.1 DUF4055 domain-containing protein -
  A4209_RS01720 (A4209_01715) - 362037..363308 (-) 1272 WP_064775652.1 terminase large subunit domain-containing protein -
  A4209_RS01725 (A4209_01720) - 363311..363901 (-) 591 WP_081273988.1 HGGxSTG domain-containing protein -
  A4209_RS01730 (A4209_01725) - 364217..364645 (-) 429 WP_016533416.1 hypothetical protein -
  A4209_RS01735 (A4209_01730) - 364632..365333 (-) 702 WP_064775651.1 hypothetical protein -
  A4209_RS01740 (A4209_01735) - 365472..365852 (+) 381 WP_064775650.1 hypothetical protein -
  A4209_RS01745 (A4209_01740) - 365840..366094 (+) 255 WP_064775649.1 HTH domain-containing protein -
  A4209_RS01750 (A4209_01745) - 366224..366580 (-) 357 WP_064775648.1 hypothetical protein -
  A4209_RS01760 (A4209_01750) - 366859..367182 (-) 324 WP_016569983.1 DUF2570 family protein -
  A4209_RS01765 (A4209_01755) - 367185..367769 (-) 585 WP_016533462.1 glycoside hydrolase family 19 protein -
  A4209_RS01770 (A4209_01760) - 367741..368106 (-) 366 WP_016533461.1 phage holin, lambda family -
  A4209_RS11250 - 368320..368505 (-) 186 WP_143930513.1 hypothetical protein -
  A4209_RS01775 (A4209_01765) - 368695..369060 (-) 366 WP_016533470.1 antiterminator Q family protein -
  A4209_RS01780 (A4209_01770) - 369060..369662 (-) 603 WP_064775605.1 recombination protein NinG -
  A4209_RS01785 (A4209_01775) - 369750..369962 (-) 213 WP_016533468.1 hypothetical protein -
  A4209_RS01790 (A4209_01780) - 370036..370494 (-) 459 WP_016569985.1 recombination protein NinB -
  A4209_RS01795 (A4209_01785) - 370484..371020 (-) 537 WP_014391470.1 phage N-6-adenine-methyltransferase -
  A4209_RS01800 (A4209_01790) - 371024..371713 (-) 690 WP_016533441.1 replication protein P -
  A4209_RS01805 (A4209_01795) - 371713..372615 (-) 903 WP_016533442.1 hypothetical protein -
  A4209_RS01810 (A4209_01800) - 372617..372970 (-) 354 WP_014390722.1 HNH endonuclease -
  A4209_RS01815 (A4209_01805) - 372967..373668 (-) 702 WP_064775604.1 phage antirepressor KilAC domain-containing protein -
  A4209_RS01820 (A4209_01810) - 373726..374001 (-) 276 WP_005756640.1 hypothetical protein -
  A4209_RS01825 (A4209_01815) - 374022..374231 (-) 210 WP_005720263.1 helix-turn-helix transcriptional regulator -
  A4209_RS01830 (A4209_01820) - 374359..375048 (+) 690 WP_064775603.1 XRE family transcriptional regulator -
  A4209_RS01835 (A4209_01825) - 375194..375457 (+) 264 WP_016533478.1 type II toxin-antitoxin system HicA family toxin -
  A4209_RS01840 (A4209_01830) - 375460..375939 (+) 480 WP_016533477.1 type II toxin-antitoxin system HicB family antitoxin -
  A4209_RS01845 (A4209_01835) - 375936..376319 (+) 384 WP_016533476.1 hypothetical protein -
  A4209_RS01850 (A4209_01840) - 376938..377168 (+) 231 WP_016533507.1 hypothetical protein -
  A4209_RS11255 - 377493..377621 (+) 129 WP_023430120.1 KilA-N domain-containing protein -
  A4209_RS01860 (A4209_01845) - 377760..378305 (+) 546 WP_016533491.1 hypothetical protein -
  A4209_RS01865 (A4209_01850) - 378571..379218 (+) 648 WP_016570070.1 Bro-N domain-containing protein -
  A4209_RS01870 (A4209_01855) - 379280..379591 (-) 312 WP_014390710.1 hypothetical protein -
  A4209_RS01875 (A4209_01860) - 379658..379942 (+) 285 WP_064775602.1 hypothetical protein -
  A4209_RS01880 (A4209_01865) - 379929..380165 (+) 237 WP_016570068.1 hypothetical protein -
  A4209_RS11185 - 380179..380340 (+) 162 WP_014390707.1 hypothetical protein -
  A4209_RS01885 (A4209_01870) - 380343..381323 (+) 981 WP_101766859.1 hypothetical protein -
  A4209_RS01890 (A4209_01875) bet 381327..382178 (+) 852 WP_016533454.1 phage recombination protein Bet -
  A4209_RS01895 (A4209_01880) - 382171..382782 (+) 612 WP_064775601.1 YqaJ viral recombinase family protein -
  A4209_RS01900 (A4209_01885) ssb 382786..383250 (+) 465 WP_016570065.1 single-stranded DNA-binding protein Machinery gene
  A4209_RS01905 (A4209_01890) - 383262..383453 (+) 192 WP_016533530.1 hypothetical protein -
  A4209_RS01910 (A4209_01895) - 383496..383849 (+) 354 WP_016570064.1 hypothetical protein -
  A4209_RS01915 (A4209_01900) - 383921..384709 (+) 789 WP_014391448.1 DUF2303 family protein -
  A4209_RS01920 (A4209_01905) - 384760..385359 (+) 600 WP_064775647.1 hypothetical protein -
  A4209_RS01925 (A4209_01910) - 385356..385721 (+) 366 WP_016533502.1 hypothetical protein -
  A4209_RS11395 - 385754..385921 (+) 168 WP_391527361.1 hypothetical protein -
  A4209_RS01935 (A4209_01915) - 385933..386421 (+) 489 WP_064775646.1 DUF551 domain-containing protein -
  A4209_RS01940 (A4209_01920) - 386525..387433 (+) 909 WP_015691048.1 P63C domain-containing protein -
  A4209_RS01945 (A4209_01925) - 387678..387899 (+) 222 WP_064775645.1 hypothetical protein -
  A4209_RS01950 (A4209_01930) - 387910..388632 (+) 723 WP_014391442.1 phage antirepressor KilAC domain-containing protein -
  A4209_RS01955 - 388816..389118 (+) 303 WP_075271365.1 helix-turn-helix domain-containing protein -
  A4209_RS01960 (A4209_01935) - 389022..390077 (+) 1056 WP_014391441.1 tyrosine-type recombinase/integrase -
  A4209_RS01975 (A4209_01950) folD 390452..391306 (+) 855 WP_005725034.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  A4209_RS01985 (A4209_01955) tnpA 391883..392347 (-) 465 WP_014325726.1 IS200/IS605 family transposase -
  A4209_RS01990 (A4209_01960) ssb 392530..393030 (-) 501 WP_005719438.1 single-stranded DNA-binding protein Machinery gene
  A4209_RS01995 (A4209_01965) uvrA 393202..396033 (+) 2832 WP_014326374.1 excinuclease ABC subunit UvrA -
  A4209_RS02000 (A4209_01970) sodC 396104..396664 (+) 561 Protein_395 superoxide dismutase [Cu-Zn] SodC -
  A4209_RS02005 (A4209_01975) rlmB 396750..397487 (-) 738 WP_005719446.1 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB -
  A4209_RS02010 (A4209_01980) rnr 397488..399890 (-) 2403 WP_014326373.1 ribonuclease R -

Sequence

Protein


Download         Length: 166 a.a.        Molecular weight: 18673.68 Da        Isoelectric Point: 5.3353

>NTDB_id=181019 A4209_RS01990 WP_005719438.1 392530..393030(-) (ssb) [Pasteurella multocida strain USDA-ARS-USMARC-60381]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTASPQYNAPTGGYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF

Nucleotide


Download         Length: 501 bp        

>NTDB_id=181019 A4209_RS01990 WP_005719438.1 392530..393030(-) (ssb) [Pasteurella multocida strain USDA-ARS-USMARC-60381]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAAGGG
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGACCGCTACACTACCGAGATCCAAGGCGACGTGTTGCAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTATGCCCCACAAACCGCTTCGCCACAATATAATGCCCCAACAG
GTGGCTACGGCGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

69.231

100

0.759
  ssb Vibrio cholerae strain A1552

53.591

100

0.584
  ssb Neisseria meningitidis MC58

44.068

100

0.47
  ssb Neisseria gonorrhoeae MS11

44.068

100

0.47

Multiple sequence alignment