Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   A4A60_RS13180 Genome accession   NZ_CP015222
Coordinates   2468803..2469177 (-) Length   124 a.a.
NCBI ID   WP_069837632.1    Uniprot ID   -
Organism   Bacillus subtilis strain HRBS-10TDI13     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2463803..2474177
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A4A60_RS13140 (A4A60_13150) yqhG 2464135..2464929 (+) 795 WP_014480249.1 YqhG family protein -
  A4A60_RS13145 (A4A60_13155) sinI 2465112..2465285 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  A4A60_RS13150 (A4A60_13160) sinR 2465319..2465654 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  A4A60_RS13155 (A4A60_13165) tasA 2465747..2466532 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  A4A60_RS13160 (A4A60_13170) sipW 2466596..2467168 (-) 573 WP_003230181.1 signal peptidase I SipW -
  A4A60_RS13165 (A4A60_13175) tapA 2467152..2467913 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  A4A60_RS13170 (A4A60_13180) yqzG 2468185..2468511 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  A4A60_RS13175 (A4A60_13185) spoIITA 2468553..2468732 (-) 180 WP_014480252.1 YqzE family protein -
  A4A60_RS13180 (A4A60_13190) comGG 2468803..2469177 (-) 375 WP_069837632.1 ComG operon protein ComGG Machinery gene
  A4A60_RS13185 (A4A60_13195) comGF 2469178..2469561 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  A4A60_RS13190 (A4A60_13200) comGE 2469587..2469934 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  A4A60_RS13195 (A4A60_13205) comGD 2469918..2470349 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  A4A60_RS13200 (A4A60_13210) comGC 2470339..2470635 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  A4A60_RS13205 (A4A60_13215) comGB 2470649..2471686 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  A4A60_RS13210 (A4A60_13220) comGA 2471673..2472743 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  A4A60_RS13220 (A4A60_13230) - 2472955..2473152 (-) 198 WP_014480259.1 CBS domain-containing protein -
  A4A60_RS13225 (A4A60_13235) corA 2473154..2474107 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=177657 A4A60_RS13180 WP_069837632.1 2468803..2469177(-) (comGG) [Bacillus subtilis strain HRBS-10TDI13]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSLRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=177657 A4A60_RS13180 WP_069837632.1 2468803..2469177(-) (comGG) [Bacillus subtilis strain HRBS-10TDI13]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGCTTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment