Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   A4A60_RS13145 Genome accession   NZ_CP015222
Coordinates   2465112..2465285 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain HRBS-10TDI13     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2460112..2470285
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A4A60_RS13130 (A4A60_13140) gcvT 2460912..2462000 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  A4A60_RS13135 (A4A60_13145) hepAA 2462441..2464114 (+) 1674 WP_038829735.1 SNF2-related protein -
  A4A60_RS13140 (A4A60_13150) yqhG 2464135..2464929 (+) 795 WP_014480249.1 YqhG family protein -
  A4A60_RS13145 (A4A60_13155) sinI 2465112..2465285 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  A4A60_RS13150 (A4A60_13160) sinR 2465319..2465654 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  A4A60_RS13155 (A4A60_13165) tasA 2465747..2466532 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  A4A60_RS13160 (A4A60_13170) sipW 2466596..2467168 (-) 573 WP_003230181.1 signal peptidase I SipW -
  A4A60_RS13165 (A4A60_13175) tapA 2467152..2467913 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  A4A60_RS13170 (A4A60_13180) yqzG 2468185..2468511 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  A4A60_RS13175 (A4A60_13185) spoIITA 2468553..2468732 (-) 180 WP_014480252.1 YqzE family protein -
  A4A60_RS13180 (A4A60_13190) comGG 2468803..2469177 (-) 375 WP_069837632.1 ComG operon protein ComGG Machinery gene
  A4A60_RS13185 (A4A60_13195) comGF 2469178..2469561 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  A4A60_RS13190 (A4A60_13200) comGE 2469587..2469934 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=177655 A4A60_RS13145 WP_003230187.1 2465112..2465285(+) (sinI) [Bacillus subtilis strain HRBS-10TDI13]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=177655 A4A60_RS13145 WP_003230187.1 2465112..2465285(+) (sinI) [Bacillus subtilis strain HRBS-10TDI13]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment