Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | AZI96_RS11530 | Genome accession | NZ_CP014618 |
| Coordinates | 2413019..2413420 (+) | Length | 133 a.a. |
| NCBI ID | WP_069359809.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain Pm-3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 2388823..2412953 | 2413019..2413420 | flank | 66 |
Gene organization within MGE regions
Location: 2388823..2413420
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AZI96_RS11340 (AZI96_11340) | - | 2388823..2389041 (-) | 219 | WP_015691070.1 | hypothetical protein | - |
| AZI96_RS11345 (AZI96_11345) | - | 2389044..2390657 (-) | 1614 | WP_231140380.1 | minor capsid protein | - |
| AZI96_RS11350 (AZI96_11350) | - | 2390635..2392038 (-) | 1404 | WP_064775653.1 | DUF4055 domain-containing protein | - |
| AZI96_RS11355 (AZI96_11355) | - | 2392048..2393319 (-) | 1272 | WP_064775652.1 | terminase large subunit domain-containing protein | - |
| AZI96_RS11360 (AZI96_11360) | - | 2393322..2393912 (-) | 591 | WP_081273988.1 | HGGxSTG domain-containing protein | - |
| AZI96_RS11365 (AZI96_11365) | - | 2394228..2394656 (-) | 429 | WP_016533416.1 | hypothetical protein | - |
| AZI96_RS11370 (AZI96_11370) | - | 2394643..2395344 (-) | 702 | WP_064775651.1 | hypothetical protein | - |
| AZI96_RS11375 (AZI96_11375) | - | 2395483..2395863 (+) | 381 | WP_064775650.1 | hypothetical protein | - |
| AZI96_RS11380 (AZI96_11380) | - | 2395851..2396105 (+) | 255 | WP_064775649.1 | HTH domain-containing protein | - |
| AZI96_RS11385 (AZI96_11385) | - | 2396235..2396591 (-) | 357 | WP_064775648.1 | hypothetical protein | - |
| AZI96_RS12080 | - | 2396683..2396964 (-) | 282 | WP_080673116.1 | hypothetical protein | - |
| AZI96_RS11390 (AZI96_11390) | - | 2396870..2397193 (-) | 324 | WP_016569983.1 | DUF2570 family protein | - |
| AZI96_RS11395 (AZI96_11395) | - | 2397196..2397780 (-) | 585 | WP_016533462.1 | glycoside hydrolase family 19 protein | - |
| AZI96_RS11400 (AZI96_11400) | - | 2397752..2398117 (-) | 366 | WP_016533461.1 | phage holin, lambda family | - |
| AZI96_RS11815 | - | 2398331..2398516 (-) | 186 | WP_143930513.1 | hypothetical protein | - |
| AZI96_RS11405 (AZI96_11405) | - | 2398706..2399071 (-) | 366 | WP_016533470.1 | antiterminator Q family protein | - |
| AZI96_RS11410 (AZI96_11410) | - | 2399071..2399673 (-) | 603 | WP_064775605.1 | recombination protein NinG | - |
| AZI96_RS11415 (AZI96_11415) | - | 2399761..2399973 (-) | 213 | WP_016533468.1 | hypothetical protein | - |
| AZI96_RS11420 (AZI96_11420) | - | 2400047..2400505 (-) | 459 | WP_016569985.1 | recombination protein NinB | - |
| AZI96_RS11425 (AZI96_11425) | - | 2400495..2401031 (-) | 537 | WP_014391470.1 | phage N-6-adenine-methyltransferase | - |
| AZI96_RS11430 (AZI96_11430) | - | 2401035..2401724 (-) | 690 | WP_016533441.1 | replication protein P | - |
| AZI96_RS11435 (AZI96_11435) | - | 2401724..2402626 (-) | 903 | WP_016533442.1 | hypothetical protein | - |
| AZI96_RS11440 (AZI96_11440) | - | 2402628..2402981 (-) | 354 | WP_014390722.1 | HNH endonuclease | - |
| AZI96_RS11445 (AZI96_11445) | - | 2402978..2403679 (-) | 702 | WP_064775604.1 | phage antirepressor KilAC domain-containing protein | - |
| AZI96_RS11450 (AZI96_11450) | - | 2403737..2404012 (-) | 276 | WP_005756640.1 | hypothetical protein | - |
| AZI96_RS11455 (AZI96_11455) | - | 2404033..2404242 (-) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| AZI96_RS11460 (AZI96_11460) | - | 2404370..2405059 (+) | 690 | WP_064775603.1 | XRE family transcriptional regulator | - |
| AZI96_RS11465 (AZI96_11465) | - | 2405205..2405468 (+) | 264 | WP_016533478.1 | type II toxin-antitoxin system HicA family toxin | - |
| AZI96_RS11470 (AZI96_11470) | - | 2405471..2405950 (+) | 480 | WP_016533477.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| AZI96_RS11475 (AZI96_11475) | - | 2405947..2406330 (+) | 384 | WP_016533476.1 | hypothetical protein | - |
| AZI96_RS11480 (AZI96_11480) | - | 2406949..2407179 (+) | 231 | WP_016533507.1 | hypothetical protein | - |
| AZI96_RS11485 (AZI96_11485) | - | 2407404..2407667 (+) | 264 | WP_014391456.1 | hypothetical protein | - |
| AZI96_RS11490 (AZI96_11490) | - | 2407755..2408288 (+) | 534 | WP_014391102.1 | hypothetical protein | - |
| AZI96_RS12030 | - | 2408289..2408414 (-) | 126 | WP_014391103.1 | hypothetical protein | - |
| AZI96_RS11495 (AZI96_11495) | - | 2408749..2409384 (+) | 636 | WP_016569990.1 | Bro-N domain-containing protein | - |
| AZI96_RS11500 (AZI96_11500) | - | 2409446..2409757 (-) | 312 | WP_014390710.1 | hypothetical protein | - |
| AZI96_RS11505 (AZI96_11505) | - | 2409824..2410108 (+) | 285 | WP_064775602.1 | hypothetical protein | - |
| AZI96_RS11510 (AZI96_11510) | - | 2410095..2410331 (+) | 237 | WP_016570068.1 | hypothetical protein | - |
| AZI96_RS11875 | - | 2410345..2410506 (+) | 162 | WP_014390707.1 | hypothetical protein | - |
| AZI96_RS11515 (AZI96_11515) | - | 2410509..2411495 (+) | 987 | WP_016570067.1 | hypothetical protein | - |
| AZI96_RS11520 (AZI96_11520) | bet | 2411499..2412113 (+) | 615 | WP_231140381.1 | phage recombination protein Bet | - |
| AZI96_RS11970 | - | 2412122..2412349 (+) | 228 | WP_231140382.1 | hypothetical protein | - |
| AZI96_RS11525 (AZI96_11525) | - | 2412342..2412953 (+) | 612 | WP_064775601.1 | YqaJ viral recombinase family protein | - |
| AZI96_RS11530 (AZI96_11530) | ssb | 2413019..2413420 (+) | 402 | WP_069359809.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 133 a.a. Molecular weight: 15042.49 Da Isoelectric Point: 6.9802
>NTDB_id=172746 AZI96_RS11530 WP_069359809.1 2413019..2413420(+) (ssb) [Pasteurella multocida strain Pm-3]
MPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEGRLRTRKWQDQNGQDRYTTEIQ
GDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF
MPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEGRLRTRKWQDQNGQDRYTTEIQ
GDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF
Nucleotide
Download Length: 402 bp
>NTDB_id=172746 AZI96_RS11530 WP_069359809.1 2413019..2413420(+) (ssb) [Pasteurella multocida strain Pm-3]
ATGCCAAATGGCGACGCAGTGGCAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATCGACAAAAACACGAACGAGCGAAA
AACGCAGACAGAATGGCACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAAAAAGGATCGA
AAGTGTATGTGGAAGGGCGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAA
GGCGACGTATTGCAGATGTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCA
AAACAATGCTTATGCCAATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTT
AA
ATGCCAAATGGCGACGCAGTGGCAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATCGACAAAAACACGAACGAGCGAAA
AACGCAGACAGAATGGCACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAAAAAGGATCGA
AAGTGTATGTGGAAGGGCGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAA
GGCGACGTATTGCAGATGTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCA
AAACAATGCTTATGCCAATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTT
AA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
58.75 |
100 |
0.707 |
| ssb | Vibrio cholerae strain A1552 |
45.161 |
100 |
0.526 |
| ssb | Neisseria meningitidis MC58 |
40.645 |
100 |
0.474 |
| ssb | Neisseria gonorrhoeae MS11 |
40.645 |
100 |
0.474 |