Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DSM2777_RS11005 | Genome accession | NZ_CP014608 |
| Coordinates | 2330877..2331377 (-) | Length | 166 a.a. |
| NCBI ID | WP_061553961.1 | Uniprot ID | - |
| Organism | Obesumbacterium proteus strain DSM 2777 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2325939..2373451 | 2330877..2331377 | within | 0 |
Gene organization within MGE regions
Location: 2325939..2373451
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DSM2777_RS10955 (DSM2777_10955) | - | 2325939..2327222 (-) | 1284 | WP_061553954.1 | tyrosine-type recombinase/integrase | - |
| DSM2777_RS10960 (DSM2777_10960) | xisR | 2327256..2327510 (-) | 255 | WP_418009335.1 | excisionase family protein | - |
| DSM2777_RS10970 (DSM2777_10970) | - | 2327706..2328248 (-) | 543 | WP_061553957.1 | phage N-6-adenine-methyltransferase | - |
| DSM2777_RS10975 (DSM2777_10975) | - | 2328245..2328484 (-) | 240 | WP_061553958.1 | DUF4060 family protein | - |
| DSM2777_RS10980 (DSM2777_10980) | - | 2328462..2328746 (-) | 285 | WP_035502976.1 | DUF5405 family protein | - |
| DSM2777_RS10985 (DSM2777_10985) | - | 2328967..2329458 (-) | 492 | WP_061553959.1 | hypothetical protein | - |
| DSM2777_RS10990 (DSM2777_10990) | - | 2329451..2330086 (-) | 636 | WP_061555380.1 | hypothetical protein | - |
| DSM2777_RS10995 (DSM2777_10995) | - | 2330124..2330531 (-) | 408 | WP_052739797.1 | hypothetical protein | - |
| DSM2777_RS11000 (DSM2777_11000) | - | 2330541..2330864 (-) | 324 | WP_061553960.1 | hypothetical protein | - |
| DSM2777_RS11005 (DSM2777_11005) | ssb | 2330877..2331377 (-) | 501 | WP_061553961.1 | single-stranded DNA-binding protein | Machinery gene |
| DSM2777_RS11010 (DSM2777_11010) | - | 2331378..2332118 (-) | 741 | WP_237087847.1 | ATP-binding protein | - |
| DSM2777_RS11015 (DSM2777_11015) | exoX | 2332248..2332919 (-) | 672 | WP_046360914.1 | exodeoxyribonuclease X | - |
| DSM2777_RS11020 (DSM2777_11020) | - | 2333064..2333270 (-) | 207 | WP_061553962.1 | hypothetical protein | - |
| DSM2777_RS11025 (DSM2777_11025) | - | 2333525..2334559 (-) | 1035 | WP_061553963.1 | hypothetical protein | - |
| DSM2777_RS24955 (DSM2777_11030) | - | 2334732..2335109 (-) | 378 | WP_061553681.1 | hypothetical protein | - |
| DSM2777_RS11035 (DSM2777_11035) | - | 2335142..2335618 (-) | 477 | WP_061553964.1 | pentapeptide repeat-containing protein | - |
| DSM2777_RS11040 (DSM2777_11040) | - | 2335666..2336019 (-) | 354 | WP_061553965.1 | hypothetical protein | - |
| DSM2777_RS11045 (DSM2777_11045) | - | 2336060..2336341 (-) | 282 | WP_061553966.1 | hypothetical protein | - |
| DSM2777_RS11050 (DSM2777_11050) | - | 2336830..2337219 (-) | 390 | WP_061553967.1 | protein-export chaperone SecB | - |
| DSM2777_RS11055 (DSM2777_11055) | - | 2337222..2337908 (-) | 687 | WP_061553968.1 | helix-turn-helix domain-containing protein | - |
| DSM2777_RS11060 (DSM2777_11060) | - | 2337905..2338210 (-) | 306 | WP_224452323.1 | type II toxin-antitoxin system HigB family toxin | - |
| DSM2777_RS11065 (DSM2777_11065) | - | 2338300..2338962 (-) | 663 | WP_061553969.1 | LexA family protein | - |
| DSM2777_RS11070 (DSM2777_11070) | - | 2339078..2339287 (+) | 210 | WP_061553970.1 | helix-turn-helix transcriptional regulator | - |
| DSM2777_RS11075 (DSM2777_11075) | - | 2339416..2339709 (+) | 294 | WP_061553686.1 | CII family transcriptional regulator | - |
| DSM2777_RS11080 (DSM2777_11080) | - | 2339780..2340652 (+) | 873 | WP_061553971.1 | replication protein | - |
| DSM2777_RS11085 (DSM2777_11085) | - | 2340649..2341500 (+) | 852 | WP_174521853.1 | ATP-binding protein | - |
| DSM2777_RS11090 (DSM2777_11090) | - | 2341467..2341922 (+) | 456 | WP_156088378.1 | hypothetical protein | - |
| DSM2777_RS11095 (DSM2777_11095) | - | 2341932..2342174 (+) | 243 | WP_061553974.1 | hypothetical protein | - |
| DSM2777_RS11100 (DSM2777_11100) | - | 2342186..2342458 (+) | 273 | WP_061553975.1 | hypothetical protein | - |
| DSM2777_RS11105 (DSM2777_11105) | - | 2342458..2342898 (+) | 441 | WP_061553692.1 | recombination protein NinB | - |
| DSM2777_RS24465 | - | 2342895..2343062 (+) | 168 | WP_096080455.1 | NinE family protein | - |
| DSM2777_RS11110 (DSM2777_11110) | - | 2343055..2343483 (+) | 429 | WP_061553693.1 | phage protein NinX family protein | - |
| DSM2777_RS11115 (DSM2777_11115) | - | 2343476..2344162 (+) | 687 | WP_061553976.1 | metallophosphoesterase | - |
| DSM2777_RS11120 (DSM2777_11120) | - | 2344155..2344445 (+) | 291 | WP_025796672.1 | DUF1364 domain-containing protein | - |
| DSM2777_RS11125 (DSM2777_11125) | - | 2344442..2344804 (+) | 363 | WP_061553695.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DSM2777_RS11130 (DSM2777_11130) | - | 2344801..2345004 (+) | 204 | WP_061553696.1 | protein ninH | - |
| DSM2777_RS11135 (DSM2777_11135) | - | 2345121..2345615 (+) | 495 | WP_156088273.1 | hypothetical protein | - |
| DSM2777_RS11145 (DSM2777_11145) | - | 2346186..2346404 (+) | 219 | WP_061553977.1 | class II holin family protein | - |
| DSM2777_RS11150 (DSM2777_11150) | - | 2346401..2346943 (+) | 543 | WP_061553978.1 | lysozyme | - |
| DSM2777_RS24470 (DSM2777_11155) | - | 2346940..2347389 (+) | 450 | WP_043494640.1 | lysis protein | - |
| DSM2777_RS11160 (DSM2777_11160) | - | 2347432..2347620 (+) | 189 | WP_061553699.1 | hypothetical protein | - |
| DSM2777_RS11165 (DSM2777_11165) | - | 2347927..2348469 (+) | 543 | WP_061553700.1 | KilA-N domain-containing protein | - |
| DSM2777_RS11170 (DSM2777_11170) | - | 2348466..2348870 (+) | 405 | WP_061553979.1 | hypothetical protein | - |
| DSM2777_RS11175 (DSM2777_11175) | - | 2348857..2349042 (+) | 186 | WP_061553980.1 | hypothetical protein | - |
| DSM2777_RS23765 | - | 2349366..2349941 (+) | 576 | WP_071889898.1 | terminase small subunit | - |
| DSM2777_RS11185 (DSM2777_11185) | - | 2349928..2351268 (+) | 1341 | WP_174521854.1 | PBSX family phage terminase large subunit | - |
| DSM2777_RS11190 (DSM2777_11190) | - | 2351278..2352537 (+) | 1260 | WP_061553981.1 | DUF1073 domain-containing protein | - |
| DSM2777_RS11195 (DSM2777_11195) | - | 2352527..2353336 (+) | 810 | WP_061553982.1 | phage minor head protein | - |
| DSM2777_RS11200 (DSM2777_11200) | - | 2353349..2354449 (+) | 1101 | WP_061553983.1 | DUF2213 domain-containing protein | - |
| DSM2777_RS11205 (DSM2777_11205) | - | 2354449..2354964 (+) | 516 | WP_061553984.1 | structural cement protein Gp24 | - |
| DSM2777_RS11210 (DSM2777_11210) | - | 2354974..2355912 (+) | 939 | WP_061553985.1 | DUF2184 domain-containing protein | - |
| DSM2777_RS11215 (DSM2777_11215) | - | 2355946..2356149 (+) | 204 | WP_004094691.1 | hypothetical protein | - |
| DSM2777_RS11220 (DSM2777_11220) | - | 2356149..2356556 (+) | 408 | WP_061553986.1 | DUF4054 domain-containing protein | - |
| DSM2777_RS11225 (DSM2777_11225) | - | 2356547..2357008 (+) | 462 | WP_025796645.1 | hypothetical protein | - |
| DSM2777_RS11230 (DSM2777_11230) | - | 2357005..2357352 (+) | 348 | WP_004094694.1 | hypothetical protein | - |
| DSM2777_RS11235 (DSM2777_11235) | - | 2357345..2357884 (+) | 540 | WP_061553987.1 | LIC_12616 family protein | - |
| DSM2777_RS11240 (DSM2777_11240) | - | 2357903..2359243 (+) | 1341 | WP_061553988.1 | DUF3383 family protein | - |
| DSM2777_RS11245 (DSM2777_11245) | - | 2359246..2359692 (+) | 447 | WP_061553989.1 | phage structural protein | - |
| DSM2777_RS11250 (DSM2777_11250) | - | 2359735..2360166 (+) | 432 | WP_061553990.1 | phage tail assembly chaperone | - |
| DSM2777_RS11255 (DSM2777_11255) | - | 2360328..2361971 (+) | 1644 | WP_061553991.1 | tape measure protein | - |
| DSM2777_RS11260 (DSM2777_11260) | - | 2361973..2362683 (+) | 711 | WP_039189911.1 | phage baseplate protein | - |
| DSM2777_RS11265 (DSM2777_11265) | - | 2362683..2363024 (+) | 342 | WP_061553992.1 | phage baseplate plug family protein | - |
| DSM2777_RS11270 (DSM2777_11270) | - | 2362999..2363934 (+) | 936 | WP_061553993.1 | phage protein | - |
| DSM2777_RS11275 (DSM2777_11275) | - | 2363934..2364608 (+) | 675 | WP_061553994.1 | Gp138 family membrane-puncturing spike protein | - |
| DSM2777_RS11280 (DSM2777_11280) | - | 2364608..2364949 (+) | 342 | WP_061553995.1 | hypothetical protein | - |
| DSM2777_RS11285 (DSM2777_11285) | - | 2365015..2366433 (+) | 1419 | WP_061553996.1 | baseplate J/gp47 family protein | - |
| DSM2777_RS11290 (DSM2777_11290) | - | 2366426..2367181 (+) | 756 | WP_237087837.1 | hypothetical protein | - |
| DSM2777_RS11295 (DSM2777_11295) | - | 2367189..2367425 (+) | 237 | WP_061553998.1 | hypothetical protein | - |
| DSM2777_RS11300 (DSM2777_11300) | - | 2367425..2368069 (+) | 645 | WP_061553999.1 | phage baseplate protein | - |
| DSM2777_RS24960 (DSM2777_11305) | - | 2368069..2370102 (+) | 2034 | WP_061554000.1 | hypothetical protein | - |
| DSM2777_RS11310 (DSM2777_11310) | - | 2370118..2371551 (-) | 1434 | WP_061554001.1 | glucosyltransferase domain-containing protein | - |
| DSM2777_RS11315 (DSM2777_11315) | - | 2371544..2372470 (-) | 927 | WP_061554002.1 | glycosyltransferase family 2 protein | - |
| DSM2777_RS11320 (DSM2777_11320) | - | 2372467..2372832 (-) | 366 | WP_025796609.1 | GtrA family protein | - |
| DSM2777_RS11325 (DSM2777_11325) | - | 2373074..2373451 (+) | 378 | WP_061554003.1 | S24 family peptidase | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 17840.00 Da Isoelectric Point: 5.2456
>NTDB_id=172622 DSM2777_RS11005 WP_061553961.1 2330877..2331377(-) (ssb) [Obesumbacterium proteus strain DSM 2777]
MASRGVNKVILVGNLGNDPEVRYMPNGGAVANITLATSESWRDKQTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGYQVYI
EGALQTRKWTDQAGVEKYTTEIVVNVGGTMQMLGGRQGGGAPMGGGQAQGNQFSGGLLPAARPQSTPAAQPQSNEPPMDF
DDDIPF
MASRGVNKVILVGNLGNDPEVRYMPNGGAVANITLATSESWRDKQTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGYQVYI
EGALQTRKWTDQAGVEKYTTEIVVNVGGTMQMLGGRQGGGAPMGGGQAQGNQFSGGLLPAARPQSTPAAQPQSNEPPMDF
DDDIPF
Nucleotide
Download Length: 501 bp
>NTDB_id=172622 DSM2777_RS11005 WP_061553961.1 2330877..2331377(-) (ssb) [Obesumbacterium proteus strain DSM 2777]
ATGGCGAGCAGAGGCGTAAATAAAGTAATCCTTGTCGGGAATTTGGGAAATGATCCAGAAGTTCGATACATGCCTAACGG
AGGCGCAGTCGCAAACATCACGCTAGCCACATCAGAGAGCTGGCGTGACAAACAGACTGGCGAGCAGAAGGAAAAAACTG
AGTGGCATCGCGTAGTGCTATTCGGAAAGCTGGCTGAGGTTGCTGGTGAATATCTGCGTAAAGGTTATCAGGTTTATATC
GAAGGTGCTTTGCAGACTCGTAAGTGGACAGATCAGGCTGGTGTTGAAAAATACACCACTGAGATTGTTGTAAACGTTGG
CGGCACCATGCAGATGCTGGGTGGACGTCAAGGTGGCGGTGCGCCTATGGGCGGCGGTCAGGCACAGGGTAATCAGTTCA
GCGGCGGCTTACTGCCAGCGGCTCGCCCTCAGAGCACTCCAGCAGCTCAGCCACAAAGCAATGAACCTCCAATGGACTTC
GATGACGACATTCCTTTCTAG
ATGGCGAGCAGAGGCGTAAATAAAGTAATCCTTGTCGGGAATTTGGGAAATGATCCAGAAGTTCGATACATGCCTAACGG
AGGCGCAGTCGCAAACATCACGCTAGCCACATCAGAGAGCTGGCGTGACAAACAGACTGGCGAGCAGAAGGAAAAAACTG
AGTGGCATCGCGTAGTGCTATTCGGAAAGCTGGCTGAGGTTGCTGGTGAATATCTGCGTAAAGGTTATCAGGTTTATATC
GAAGGTGCTTTGCAGACTCGTAAGTGGACAGATCAGGCTGGTGTTGAAAAATACACCACTGAGATTGTTGTAAACGTTGG
CGGCACCATGCAGATGCTGGGTGGACGTCAAGGTGGCGGTGCGCCTATGGGCGGCGGTCAGGCACAGGGTAATCAGTTCA
GCGGCGGCTTACTGCCAGCGGCTCGCCCTCAGAGCACTCCAGCAGCTCAGCCACAAAGCAATGAACCTCCAATGGACTTC
GATGACGACATTCCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
70.056 |
100 |
0.747 |
| ssb | Glaesserella parasuis strain SC1401 |
54.595 |
100 |
0.608 |
| ssb | Neisseria gonorrhoeae MS11 |
48.864 |
100 |
0.518 |
| ssb | Neisseria meningitidis MC58 |
47.727 |
100 |
0.506 |