Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   ASL15_RS01895 Genome accession   NZ_CP013955
Coordinates   414619..415122 (+) Length   167 a.a.
NCBI ID   WP_000934799.1    Uniprot ID   A0A7U7IE99
Organism   Staphylococcus aureus strain NCCP14562 isolate Sequencing     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 410462..461325 414619..415122 within 0


Gene organization within MGE regions


Location: 410462..461325
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ASL15_RS01865 (ASL15_01865) - 410559..411404 (+) 846 WP_001557587.1 ParB/RepB/Spo0J family partition protein -
  ASL15_RS01870 (ASL15_01870) - 411558..412439 (+) 882 WP_063664720.1 mechanosensitive ion channel family protein -
  ASL15_RS01875 (ASL15_01875) - 412469..412672 (+) 204 WP_000157348.1 DUF951 domain-containing protein -
  ASL15_RS01880 (ASL15_01880) ychF 412684..413781 (+) 1098 WP_001218732.1 redox-regulated ATPase YchF -
  ASL15_RS01885 (ASL15_01885) - 413867..414058 (-) 192 WP_001052484.1 hypothetical protein -
  ASL15_RS01890 (ASL15_01890) rpsF 414302..414598 (+) 297 WP_001261460.1 30S ribosomal protein S6 -
  ASL15_RS01895 (ASL15_01895) ssbA 414619..415122 (+) 504 WP_000934799.1 single-stranded DNA-binding protein Machinery gene
  ASL15_RS01900 (ASL15_01900) rpsR 415174..415416 (+) 243 WP_000897044.1 30S ribosomal protein S18 -
  ASL15_RS01905 (ASL15_01905) - 415693..416631 (-) 939 WP_001817700.1 Abi family protein -
  ASL15_RS14955 - 416670..417383 (-) 714 Protein_370 tyrosine-type recombinase/integrase -
  ASL15_RS01915 (ASL15_01915) selX 417589..418200 (+) 612 WP_000475325.1 staphylococcal enterotoxin-like toxin X -
  ASL15_RS01920 (ASL15_01920) - 418569..418937 (+) 369 WP_000849163.1 YxeA family protein -
  ASL15_RS01925 (ASL15_01925) - 419118..419690 (+) 573 WP_000769722.1 PepSY domain-containing protein -
  ASL15_RS01930 (ASL15_01930) - 419827..420090 (-) 264 WP_001055897.1 helix-turn-helix domain-containing protein -
  ASL15_RS01935 (ASL15_01935) - 420390..420641 (+) 252 WP_000466748.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  ASL15_RS01940 (ASL15_01940) - 420680..420889 (-) 210 WP_000211677.1 hypothetical protein -
  ASL15_RS01945 (ASL15_01945) - 421067..421648 (+) 582 WP_000158375.1 histidine phosphatase family protein -
  ASL15_RS01950 (ASL15_01950) - 421714..422097 (-) 384 WP_000868259.1 hypothetical protein -
  ASL15_RS01955 (ASL15_01955) - 422367..422993 (-) 627 WP_000746679.1 NDxxF motif lipoprotein -
  ASL15_RS01960 (ASL15_01960) - 423066..423301 (-) 236 Protein_380 hypothetical protein -
  ASL15_RS01965 (ASL15_01965) ahpF 423437..424960 (-) 1524 WP_000930514.1 alkyl hydroperoxide reductase subunit F -
  ASL15_RS01970 (ASL15_01970) ahpC 424976..425545 (-) 570 WP_000052781.1 alkyl hydroperoxide reductase subunit C -
  ASL15_RS01975 (ASL15_01975) - 425889..427061 (+) 1173 WP_000195429.1 IS256-like element IS256 family transposase -
  ASL15_RS01980 (ASL15_01980) nfsA 427369..428124 (+) 756 WP_001287099.1 oxygen-insensitive NADPH nitroreductase -
  ASL15_RS01985 (ASL15_01985) - 428204..429592 (-) 1389 WP_000991018.1 L-cystine transporter -
  ASL15_RS01990 (ASL15_01990) - 429677..429775 (+) 99 WP_001792089.1 hypothetical protein -
  ASL15_RS01995 (ASL15_01995) - 430439..431758 (+) 1320 WP_001557163.1 ISL3-like element IS1181 family transposase -
  ASL15_RS16180 - 431806..431877 (+) 72 WP_370591525.1 hypothetical protein -
  ASL15_RS02000 (ASL15_02000) - 432090..433046 (-) 957 WP_000956137.1 hypothetical protein -
  ASL15_RS02005 (ASL15_02005) - 433164..433826 (-) 663 WP_000394698.1 hypothetical protein -
  ASL15_RS02010 (ASL15_02010) - 433969..434376 (-) 408 WP_000763767.1 general stress protein -
  ASL15_RS02015 (ASL15_02015) xpt 434889..435467 (+) 579 WP_000421410.1 xanthine phosphoribosyltransferase -
  ASL15_RS02020 (ASL15_02020) pbuX 435467..436735 (+) 1269 WP_000793018.1 xanthine permease PbuX -
  ASL15_RS02025 (ASL15_02025) guaB 436773..438239 (+) 1467 WP_000264071.1 IMP dehydrogenase -
  ASL15_RS02030 (ASL15_02030) guaA 438264..439805 (+) 1542 WP_000424963.1 glutamine-hydrolyzing GMP synthase -
  ASL15_RS02035 (ASL15_02035) - 439873..441066 (-) 1194 WP_000237797.1 site-specific integrase -
  ASL15_RS02040 (ASL15_02040) - 441093..441293 (-) 201 WP_000633907.1 DUF3173 family protein -
  ASL15_RS02045 (ASL15_02045) - 441791..442021 (-) 231 WP_000845143.1 helix-turn-helix domain-containing protein -
  ASL15_RS02050 (ASL15_02050) - 442018..442440 (-) 423 WP_000804879.1 RNA polymerase sigma factor -
  ASL15_RS02055 (ASL15_02055) - 442971..443324 (+) 354 WP_001227350.1 helix-turn-helix domain-containing protein -
  ASL15_RS14975 - 443382..443567 (-) 186 WP_413926387.1 cysteine-rich KTR domain-containing protein -
  ASL15_RS15940 (ASL15_02060) tet(M) 443668..445586 (-) 1919 Protein_402 tetracycline resistance ribosomal protection protein Tet(M) -
  ASL15_RS14980 - 445602..445718 (-) 117 WP_001791010.1 tetracycline resistance determinant leader peptide -
  ASL15_RS02065 (ASL15_02065) - 445963..446892 (-) 930 WP_000584387.1 conjugal transfer protein -
  ASL15_RS02070 (ASL15_02070) - 446909..447931 (-) 1023 WP_000768373.1 bifunctional lytic transglycosylase/C40 family peptidase -
  ASL15_RS02075 (ASL15_02075) - 447928..449955 (-) 2028 WP_000192393.1 CD3337/EF1877 family mobilome membrane protein -
  ASL15_RS02080 (ASL15_02080) - 449952..452405 (-) 2454 WP_000331165.1 ATP-binding protein -
  ASL15_RS02085 (ASL15_02085) - 452389..452784 (-) 396 WP_000723887.1 conjugal transfer protein -
  ASL15_RS02090 (ASL15_02090) - 452856..453494 (-) 639 WP_000248477.1 DUF6037 family protein -
  ASL15_RS02095 (ASL15_02095) - 453550..454050 (-) 501 WP_000425404.1 antirestriction protein ArdA -
  ASL15_RS02100 (ASL15_02100) - 454111..454890 (-) 780 WP_000675717.1 abortive infection family protein -
  ASL15_RS02105 (ASL15_02105) - 454932..455153 (-) 222 WP_001009054.1 hypothetical protein -
  ASL15_RS02110 (ASL15_02110) - 455150..455440 (-) 291 WP_000055376.1 hypothetical protein -
  ASL15_RS02115 (ASL15_02115) mobT 455437..456621 (-) 1185 WP_000426689.1 MobT family relaxase -
  ASL15_RS02120 (ASL15_02120) - 456802..458205 (-) 1404 WP_001130244.1 FtsK/SpoIIIE domain-containing protein -
  ASL15_RS02125 (ASL15_02125) - 458227..459000 (-) 774 WP_000185761.1 hypothetical protein -
  ASL15_RS02130 (ASL15_02130) - 459010..459387 (-) 378 WP_001234191.1 YdcP family protein -
  ASL15_RS02135 (ASL15_02135) - 459408..459722 (-) 315 WP_000421279.1 YdcP family protein -
  ASL15_RS02140 (ASL15_02140) - 460023..460982 (+) 960 WP_002303350.1 IS30 family transposase -

Sequence

Protein


Download         Length: 167 a.a.        Molecular weight: 18539.12 Da        Isoelectric Point: 4.7305

>NTDB_id=166597 ASL15_RS01895 WP_000934799.1 414619..415122(+) (ssbA) [Staphylococcus aureus strain NCCP14562 isolate Sequencing]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF

Nucleotide


Download         Length: 504 bp        

>NTDB_id=166597 ASL15_RS01895 WP_000934799.1 414619..415122(+) (ssbA) [Staphylococcus aureus strain NCCP14562 isolate Sequencing]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A7U7IE99

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.341

100

0.689
  ssb Latilactobacillus sakei subsp. sakei 23K

54.971

100

0.563
  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

63.473

0.371
  ssb Glaesserella parasuis strain SC1401

34.463

100

0.365

Multiple sequence alignment