Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AVM03_RS06125 Genome accession   NZ_CP013727
Coordinates   1382818..1383195 (-) Length   125 a.a.
NCBI ID   WP_015388005.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain MBE1283     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1377818..1388195
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AVM03_RS06085 (AVM03_06080) - 1378317..1379111 (+) 795 WP_014305407.1 YqhG family protein -
  AVM03_RS06090 (AVM03_06085) sinI 1379288..1379461 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AVM03_RS06095 (AVM03_06090) sinR 1379495..1379830 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AVM03_RS06100 (AVM03_06095) tasA 1379878..1380663 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  AVM03_RS06105 (AVM03_06100) sipW 1380727..1381311 (-) 585 WP_012117977.1 signal peptidase I SipW -
  AVM03_RS06110 (AVM03_06105) tapA 1381283..1381954 (-) 672 WP_058906184.1 amyloid fiber anchoring/assembly protein TapA -
  AVM03_RS06115 (AVM03_06110) - 1382213..1382542 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  AVM03_RS06120 (AVM03_06115) - 1382582..1382761 (-) 180 WP_003153093.1 YqzE family protein -
  AVM03_RS06125 (AVM03_06120) comGG 1382818..1383195 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  AVM03_RS06130 (AVM03_06125) comGF 1383196..1383591 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  AVM03_RS06135 (AVM03_06130) comGE 1383605..1383919 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  AVM03_RS06140 (AVM03_06135) comGD 1383903..1384340 (-) 438 WP_058906185.1 competence type IV pilus minor pilin ComGD Machinery gene
  AVM03_RS06145 (AVM03_06140) comGC 1384330..1384638 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AVM03_RS06150 (AVM03_06145) comGB 1384643..1385680 (-) 1038 WP_058906186.1 competence type IV pilus assembly protein ComGB Machinery gene
  AVM03_RS06155 (AVM03_06150) comGA 1385667..1386737 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AVM03_RS06160 (AVM03_06155) - 1386929..1387879 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14182.19 Da        Isoelectric Point: 9.9592

>NTDB_id=164466 AVM03_RS06125 WP_015388005.1 1382818..1383195(-) (comGG) [Bacillus amyloliquefaciens strain MBE1283]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGIQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=164466 AVM03_RS06125 WP_015388005.1 1382818..1383195(-) (comGG) [Bacillus amyloliquefaciens strain MBE1283]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTATACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment