Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AVM03_RS06090 | Genome accession | NZ_CP013727 |
| Coordinates | 1379288..1379461 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain MBE1283 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1374288..1384461
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AVM03_RS06075 (AVM03_06070) | gcvT | 1375106..1376206 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AVM03_RS06080 (AVM03_06075) | - | 1376629..1378299 (+) | 1671 | WP_058906183.1 | DEAD/DEAH box helicase | - |
| AVM03_RS06085 (AVM03_06080) | - | 1378317..1379111 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| AVM03_RS06090 (AVM03_06085) | sinI | 1379288..1379461 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AVM03_RS06095 (AVM03_06090) | sinR | 1379495..1379830 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AVM03_RS06100 (AVM03_06095) | tasA | 1379878..1380663 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| AVM03_RS06105 (AVM03_06100) | sipW | 1380727..1381311 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| AVM03_RS06110 (AVM03_06105) | tapA | 1381283..1381954 (-) | 672 | WP_058906184.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AVM03_RS06115 (AVM03_06110) | - | 1382213..1382542 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| AVM03_RS06120 (AVM03_06115) | - | 1382582..1382761 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AVM03_RS06125 (AVM03_06120) | comGG | 1382818..1383195 (-) | 378 | WP_015388005.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AVM03_RS06130 (AVM03_06125) | comGF | 1383196..1383591 (-) | 396 | WP_015388004.1 | competence type IV pilus minor pilin ComGF | - |
| AVM03_RS06135 (AVM03_06130) | comGE | 1383605..1383919 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AVM03_RS06140 (AVM03_06135) | comGD | 1383903..1384340 (-) | 438 | WP_058906185.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=164464 AVM03_RS06090 WP_003153105.1 1379288..1379461(+) (sinI) [Bacillus amyloliquefaciens strain MBE1283]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=164464 AVM03_RS06090 WP_003153105.1 1379288..1379461(+) (sinI) [Bacillus amyloliquefaciens strain MBE1283]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |