Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AT706_RS06425 | Genome accession | NZ_CP013654 |
| Coordinates | 1240133..1240306 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain BSD-2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1235133..1245306
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT706_RS06380 (AT706_06385) | comGE | 1235485..1235832 (+) | 348 | WP_015384088.1 | ComG operon protein 5 | Machinery gene |
| AT706_RS06385 (AT706_06390) | comGF | 1235858..1236241 (+) | 384 | WP_015384087.1 | ComG operon protein ComGF | Machinery gene |
| AT706_RS06390 (AT706_06395) | comGG | 1236242..1236616 (+) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| AT706_RS06395 (AT706_06400) | spoIITA | 1236688..1236867 (+) | 180 | WP_003230176.1 | YqzE family protein | - |
| AT706_RS06400 (AT706_06405) | yqzG | 1236909..1237235 (-) | 327 | WP_015384086.1 | YqzG/YhdC family protein | - |
| AT706_RS06405 (AT706_06410) | tapA | 1237505..1238266 (+) | 762 | WP_015384085.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AT706_RS06410 (AT706_06415) | sipW | 1238250..1238822 (+) | 573 | WP_080030740.1 | signal peptidase I SipW | - |
| AT706_RS06415 (AT706_06420) | tasA | 1238886..1239671 (+) | 786 | WP_003230183.1 | biofilm matrix protein TasA | - |
| AT706_RS06420 (AT706_06425) | sinR | 1239764..1240099 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| AT706_RS06425 (AT706_06430) | sinI | 1240133..1240306 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| AT706_RS06430 (AT706_06435) | yqhG | 1240489..1241283 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| AT706_RS06435 (AT706_06440) | hepAA | 1241304..1242977 (-) | 1674 | WP_015384082.1 | DEAD/DEAH box helicase | - |
| AT706_RS06440 (AT706_06445) | gcvT | 1243419..1244507 (+) | 1089 | WP_015384081.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=163524 AT706_RS06425 WP_003230187.1 1240133..1240306(-) (sinI) [Bacillus subtilis subsp. subtilis strain BSD-2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=163524 AT706_RS06425 WP_003230187.1 1240133..1240306(-) (sinI) [Bacillus subtilis subsp. subtilis strain BSD-2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |