Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AT706_RS06385 Genome accession   NZ_CP013654
Coordinates   1235858..1236241 (+) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain BSD-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1230858..1241241
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AT706_RS06355 (AT706_06360) corA 1231313..1232266 (+) 954 WP_015483432.1 magnesium transporter CorA -
  AT706_RS06360 (AT706_06365) comGA 1232676..1233746 (+) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  AT706_RS06365 (AT706_06370) comGB 1233733..1234770 (+) 1038 WP_015483430.1 comG operon protein ComGB Machinery gene
  AT706_RS06370 (AT706_06375) comGC 1234784..1235080 (+) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  AT706_RS06375 (AT706_06380) comGD 1235070..1235501 (+) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  AT706_RS06380 (AT706_06385) comGE 1235485..1235832 (+) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  AT706_RS06385 (AT706_06390) comGF 1235858..1236241 (+) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  AT706_RS06390 (AT706_06395) comGG 1236242..1236616 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AT706_RS06395 (AT706_06400) spoIITA 1236688..1236867 (+) 180 WP_003230176.1 YqzE family protein -
  AT706_RS06400 (AT706_06405) yqzG 1236909..1237235 (-) 327 WP_015384086.1 YqzG/YhdC family protein -
  AT706_RS06405 (AT706_06410) tapA 1237505..1238266 (+) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  AT706_RS06410 (AT706_06415) sipW 1238250..1238822 (+) 573 WP_080030740.1 signal peptidase I SipW -
  AT706_RS06415 (AT706_06420) tasA 1238886..1239671 (+) 786 WP_003230183.1 biofilm matrix protein TasA -
  AT706_RS06420 (AT706_06425) sinR 1239764..1240099 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AT706_RS06425 (AT706_06430) sinI 1240133..1240306 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=163521 AT706_RS06385 WP_015384087.1 1235858..1236241(+) (comGF) [Bacillus subtilis subsp. subtilis strain BSD-2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=163521 AT706_RS06385 WP_015384087.1 1235858..1236241(+) (comGF) [Bacillus subtilis subsp. subtilis strain BSD-2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment