Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ATD26_RS08480 Genome accession   NZ_CP013352
Coordinates   1880522..1880950 (+) Length   142 a.a.
NCBI ID   WP_035764036.1    Uniprot ID   A0A2S7F9K9
Organism   Clostridium butyricum strain JKY6D1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1870621..1914529 1880522..1880950 within 0


Gene organization within MGE regions


Location: 1870621..1914529
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ATD26_RS08395 (ATD26_08395) - 1870621..1872276 (-) 1656 WP_058371751.1 recombinase family protein -
  ATD26_RS08400 (ATD26_08400) - 1872348..1872656 (-) 309 WP_058371752.1 hypothetical protein -
  ATD26_RS08405 (ATD26_08405) - 1872646..1872915 (-) 270 WP_058371753.1 DUF2442 domain-containing protein -
  ATD26_RS08410 (ATD26_08410) - 1872932..1873192 (-) 261 WP_058371754.1 DUF4160 domain-containing protein -
  ATD26_RS08415 (ATD26_08415) - 1873221..1873727 (-) 507 WP_058371755.1 helix-turn-helix domain-containing protein -
  ATD26_RS20850 - 1873956..1874105 (+) 150 WP_155594175.1 hypothetical protein -
  ATD26_RS08420 (ATD26_08420) - 1874106..1874405 (+) 300 WP_058371756.1 hypothetical protein -
  ATD26_RS08425 (ATD26_08425) - 1874374..1874559 (-) 186 WP_035764050.1 hypothetical protein -
  ATD26_RS21365 (ATD26_08430) - 1874630..1875229 (+) 600 WP_224134155.1 hypothetical protein -
  ATD26_RS20860 - 1875286..1875453 (+) 168 WP_155594176.1 hypothetical protein -
  ATD26_RS08435 (ATD26_08435) - 1875479..1875718 (+) 240 WP_035764048.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  ATD26_RS08440 (ATD26_08440) - 1875944..1876801 (+) 858 WP_058371757.1 rolling circle replication-associated protein -
  ATD26_RS08445 (ATD26_08445) - 1876785..1877168 (+) 384 WP_236901129.1 VRR-NUC domain-containing protein -
  ATD26_RS08450 (ATD26_08450) - 1877196..1877354 (+) 159 WP_035764044.1 hypothetical protein -
  ATD26_RS08455 (ATD26_08455) - 1877400..1878167 (+) 768 WP_058371758.1 ParA family protein -
  ATD26_RS08460 (ATD26_08460) - 1878173..1879165 (+) 993 WP_058371759.1 ParB/RepB/Spo0J family partition protein -
  ATD26_RS08465 (ATD26_08465) - 1879215..1879631 (+) 417 WP_058371760.1 hypothetical protein -
  ATD26_RS08470 (ATD26_08470) - 1879647..1879922 (+) 276 WP_043666071.1 hypothetical protein -
  ATD26_RS08475 (ATD26_08475) - 1879906..1880529 (+) 624 WP_058371761.1 DUF5651 domain-containing protein -
  ATD26_RS08480 (ATD26_08480) ssbA 1880522..1880950 (+) 429 WP_035764036.1 single-stranded DNA-binding protein Machinery gene
  ATD26_RS08485 (ATD26_08485) - 1880966..1881310 (+) 345 WP_035764034.1 hypothetical protein -
  ATD26_RS20630 - 1881366..1881512 (+) 147 WP_080775794.1 aspartyl-phosphate phosphatase Spo0E family protein -
  ATD26_RS21070 - 1881499..1881666 (+) 168 WP_162830847.1 hypothetical protein -
  ATD26_RS08490 (ATD26_08490) - 1881635..1881889 (+) 255 WP_035764032.1 hypothetical protein -
  ATD26_RS20865 - 1881879..1882052 (+) 174 WP_155594177.1 hypothetical protein -
  ATD26_RS08495 (ATD26_08495) - 1882079..1882525 (+) 447 WP_058371762.1 hypothetical protein -
  ATD26_RS08500 (ATD26_08500) - 1882555..1882842 (+) 288 WP_058371763.1 hypothetical protein -
  ATD26_RS20870 - 1882845..1883000 (+) 156 WP_155594178.1 hypothetical protein -
  ATD26_RS08505 (ATD26_08505) - 1882993..1883382 (+) 390 WP_058371764.1 hypothetical protein -
  ATD26_RS08510 (ATD26_08510) - 1883382..1883666 (+) 285 WP_002580799.1 hypothetical protein -
  ATD26_RS08515 (ATD26_08515) - 1883710..1883907 (+) 198 WP_058371765.1 hypothetical protein -
  ATD26_RS20875 - 1883901..1884071 (+) 171 WP_155594179.1 hypothetical protein -
  ATD26_RS08520 (ATD26_08520) - 1884114..1884353 (+) 240 WP_058371766.1 hypothetical protein -
  ATD26_RS08525 (ATD26_08525) - 1884367..1884861 (+) 495 WP_035764109.1 hypothetical protein -
  ATD26_RS08530 (ATD26_08530) - 1885019..1885318 (+) 300 WP_373866288.1 HNH endonuclease -
  ATD26_RS08535 (ATD26_08535) - 1885404..1885787 (+) 384 WP_043666037.1 P27 family phage terminase small subunit -
  ATD26_RS08540 (ATD26_08540) - 1885777..1887543 (+) 1767 WP_058371944.1 terminase large subunit -
  ATD26_RS08545 (ATD26_08545) - 1887601..1888806 (+) 1206 WP_035764025.1 phage portal protein -
  ATD26_RS08550 (ATD26_08550) - 1888799..1889377 (+) 579 WP_058371767.1 HK97 family phage prohead protease -
  ATD26_RS08555 (ATD26_08555) - 1889367..1890779 (+) 1413 WP_058371768.1 phage major capsid protein -
  ATD26_RS08560 (ATD26_08560) - 1890793..1891077 (+) 285 WP_035764019.1 hypothetical protein -
  ATD26_RS08565 (ATD26_08565) - 1891090..1891374 (+) 285 WP_035764017.1 hypothetical protein -
  ATD26_RS08570 (ATD26_08570) - 1891374..1891694 (+) 321 WP_058371769.1 hypothetical protein -
  ATD26_RS08575 (ATD26_08575) - 1891687..1892043 (+) 357 WP_035764014.1 HK97 gp10 family phage protein -
  ATD26_RS08580 (ATD26_08580) - 1892040..1892369 (+) 330 WP_058371770.1 hypothetical protein -
  ATD26_RS08585 (ATD26_08585) - 1892371..1892940 (+) 570 WP_058371771.1 major tail protein -
  ATD26_RS08590 (ATD26_08590) - 1892952..1893293 (+) 342 WP_043666011.1 hypothetical protein -
  ATD26_RS20880 - 1893347..1893496 (+) 150 WP_171781531.1 hypothetical protein -
  ATD26_RS08595 (ATD26_08595) - 1893516..1896422 (+) 2907 WP_058371772.1 hypothetical protein -
  ATD26_RS08600 (ATD26_08600) - 1896422..1897126 (+) 705 WP_058371773.1 phage tail protein -
  ATD26_RS08605 (ATD26_08605) - 1897126..1898814 (+) 1689 WP_058371774.1 phage tail spike protein -
  ATD26_RS08610 (ATD26_08610) - 1898830..1899675 (+) 846 WP_058371775.1 hypothetical protein -
  ATD26_RS08615 (ATD26_08615) - 1899704..1900216 (+) 513 WP_058371776.1 hypothetical protein -
  ATD26_RS21370 (ATD26_08620) - 1900230..1901000 (+) 771 WP_058371777.1 hypothetical protein -
  ATD26_RS08625 (ATD26_08625) - 1901000..1901257 (+) 258 WP_058371778.1 hypothetical protein -
  ATD26_RS20885 - 1901259..1901390 (+) 132 WP_155594180.1 XkdX family protein -
  ATD26_RS08630 (ATD26_08630) - 1901621..1902463 (+) 843 WP_058371779.1 DUF6236 family protein -
  ATD26_RS08635 (ATD26_08635) - 1902855..1903292 (+) 438 WP_058371780.1 phage holin family protein -
  ATD26_RS08640 (ATD26_08640) - 1903341..1904978 (+) 1638 WP_058371781.1 glycoside hydrolase family protein -
  ATD26_RS20890 (ATD26_08645) - 1905200..1905979 (+) 780 WP_058371782.1 hypothetical protein -
  ATD26_RS08650 (ATD26_08650) miaB 1906130..1907500 (+) 1371 WP_058371783.1 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB -
  ATD26_RS08655 (ATD26_08655) - 1907640..1908704 (+) 1065 WP_024040091.1 hypothetical protein -
  ATD26_RS08660 (ATD26_08660) ybaK 1908794..1909279 (-) 486 WP_043852949.1 Cys-tRNA(Pro) deacylase -
  ATD26_RS08665 (ATD26_08665) - 1910156..1911142 (+) 987 WP_003414527.1 tyrosine recombinase XerC -
  ATD26_RS08670 (ATD26_08670) - 1911203..1911760 (-) 558 WP_046058317.1 hypothetical protein -
  ATD26_RS08675 (ATD26_08675) - 1911909..1912331 (-) 423 WP_035765681.1 hypothetical protein -
  ATD26_RS08680 (ATD26_08680) lexA 1912520..1913125 (+) 606 WP_002580094.1 transcriptional repressor LexA -
  ATD26_RS08685 (ATD26_08685) - 1913243..1914529 (-) 1287 WP_058371784.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -

Sequence


Protein


Download         Length: 142 a.a.        Molecular weight: 15495.26 Da        Isoelectric Point: 4.5423

>NTDB_id=162231 ATD26_RS08480 WP_035764036.1 1880522..1880950(+) (ssbA) [Clostridium butyricum strain JKY6D1]
MNKVVLIGRLTKDPELRFTPGSGAAVTTLTLAVDRYNPKTNQNEADFIPIVIWGKQAENTANYMSKGGQVAISGKIQTRS
YDAKDGTKRYITEVVADQFGGVQFLGNKGEVNQNDGSNNFGNMNQDIFEEDITPVDGGDMPF

Nucleotide


Download         Length: 429 bp        

>NTDB_id=162231 ATD26_RS08480 WP_035764036.1 1880522..1880950(+) (ssbA) [Clostridium butyricum strain JKY6D1]
GTGAATAAAGTAGTTTTAATAGGAAGATTAACTAAAGATCCTGAACTTAGATTTACACCTGGAAGTGGTGCAGCGGTAAC
AACTTTAACATTAGCAGTTGATAGATATAATCCAAAGACTAACCAAAATGAAGCTGATTTTATTCCTATAGTAATATGGG
GTAAACAAGCTGAAAACACTGCAAATTATATGAGTAAAGGCGGACAAGTTGCTATTAGCGGAAAAATTCAAACTAGAAGT
TATGATGCTAAAGATGGTACTAAGAGATATATTACTGAAGTAGTAGCAGATCAATTTGGTGGTGTTCAGTTTCTAGGGAA
TAAGGGTGAAGTAAATCAGAATGATGGTTCTAATAATTTTGGAAATATGAATCAAGACATATTTGAAGAGGATATAACAC
CAGTAGATGGAGGGGACATGCCTTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2S7F9K9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

40.571

100

0.5

  ssb Latilactobacillus sakei subsp. sakei 23K

46.825

88.732

0.415

  ssbB Streptococcus sobrinus strain NIDR 6715-7

39.706

95.775

0.38

  ssbB Bacillus subtilis subsp. subtilis str. 168

50

76.056

0.38


Multiple sequence alignment