Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FORC27_RS01855 | Genome accession | NZ_CP012692 |
| Coordinates | 407076..407579 (+) | Length | 167 a.a. |
| NCBI ID | WP_000934799.1 | Uniprot ID | A0A7U7IE99 |
| Organism | Staphylococcus aureus strain FORC_027 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 402919..451386 | 407076..407579 | within | 0 |
Gene organization within MGE regions
Location: 402919..451386
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC27_RS01825 (FORC27_0358) | - | 403016..403861 (+) | 846 | WP_001557587.1 | ParB/RepB/Spo0J family partition protein | - |
| FORC27_RS01830 (FORC27_0359) | - | 404015..404896 (+) | 882 | WP_000373073.1 | mechanosensitive ion channel family protein | - |
| FORC27_RS01835 (FORC27_0360) | - | 404926..405129 (+) | 204 | WP_000157348.1 | DUF951 domain-containing protein | - |
| FORC27_RS01840 (FORC27_0361) | ychF | 405141..406238 (+) | 1098 | WP_001218732.1 | redox-regulated ATPase YchF | - |
| FORC27_RS01845 (FORC27_0362) | - | 406324..406515 (-) | 192 | WP_001052484.1 | hypothetical protein | - |
| FORC27_RS01850 (FORC27_0363) | rpsF | 406759..407055 (+) | 297 | WP_001261460.1 | 30S ribosomal protein S6 | - |
| FORC27_RS01855 (FORC27_0364) | ssbA | 407076..407579 (+) | 504 | WP_000934799.1 | single-stranded DNA-binding protein | Machinery gene |
| FORC27_RS01860 (FORC27_0365) | rpsR | 407631..407873 (+) | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
| FORC27_RS01865 (FORC27_0366) | - | 408150..409088 (-) | 939 | WP_001817700.1 | Abi family protein | - |
| FORC27_RS15560 | - | 409127..409840 (-) | 714 | Protein_365 | tyrosine-type recombinase/integrase | - |
| FORC27_RS01875 (FORC27_0368) | selX | 410046..410657 (+) | 612 | WP_000475325.1 | staphylococcal enterotoxin-like toxin X | - |
| FORC27_RS01880 (FORC27_0370) | - | 411026..411394 (+) | 369 | WP_000849163.1 | YxeA family protein | - |
| FORC27_RS01885 (FORC27_0371) | - | 411575..412147 (+) | 573 | WP_000769722.1 | PepSY domain-containing protein | - |
| FORC27_RS01890 (FORC27_0372) | - | 412284..412547 (-) | 264 | WP_001055897.1 | helix-turn-helix domain-containing protein | - |
| FORC27_RS01895 (FORC27_0373) | - | 412847..413098 (+) | 252 | WP_000466748.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| FORC27_RS01900 | - | 413137..413346 (-) | 210 | WP_000211677.1 | hypothetical protein | - |
| FORC27_RS01905 (FORC27_0374) | - | 413524..414105 (+) | 582 | WP_000158375.1 | histidine phosphatase family protein | - |
| FORC27_RS01910 (FORC27_0375) | - | 414171..414554 (-) | 384 | WP_000868259.1 | hypothetical protein | - |
| FORC27_RS01915 (FORC27_0377) | - | 414824..415450 (-) | 627 | WP_000746679.1 | NDxxF motif lipoprotein | - |
| FORC27_RS01920 (FORC27_0378) | - | 415523..415758 (-) | 236 | Protein_375 | hypothetical protein | - |
| FORC27_RS01925 (FORC27_0379) | ahpF | 415894..417417 (-) | 1524 | WP_000930514.1 | alkyl hydroperoxide reductase subunit F | - |
| FORC27_RS01930 (FORC27_0380) | ahpC | 417433..418002 (-) | 570 | WP_000052781.1 | alkyl hydroperoxide reductase subunit C | - |
| FORC27_RS01935 (FORC27_0381) | nfsA | 418494..419249 (+) | 756 | WP_001287099.1 | oxygen-insensitive NADPH nitroreductase | - |
| FORC27_RS01940 (FORC27_0382) | - | 419329..420717 (-) | 1389 | WP_000991018.1 | L-cystine transporter | - |
| FORC27_RS01945 | - | 420802..420900 (+) | 99 | WP_001792089.1 | hypothetical protein | - |
| FORC27_RS01950 (FORC27_0383) | - | 421564..422883 (+) | 1320 | WP_001557163.1 | ISL3-like element IS1181 family transposase | - |
| FORC27_RS16140 | - | 422931..423002 (+) | 72 | WP_370591525.1 | hypothetical protein | - |
| FORC27_RS01955 (FORC27_0384) | - | 423215..424171 (-) | 957 | WP_000956137.1 | hypothetical protein | - |
| FORC27_RS01960 (FORC27_0385) | - | 424289..424951 (-) | 663 | WP_000394698.1 | hypothetical protein | - |
| FORC27_RS01965 (FORC27_0386) | - | 425094..425501 (-) | 408 | WP_000763767.1 | general stress protein | - |
| FORC27_RS01970 (FORC27_0387) | xpt | 426014..426592 (+) | 579 | WP_000421410.1 | xanthine phosphoribosyltransferase | - |
| FORC27_RS01975 (FORC27_0388) | pbuX | 426592..427860 (+) | 1269 | WP_000793018.1 | xanthine permease PbuX | - |
| FORC27_RS01980 (FORC27_0389) | guaB | 427898..429364 (+) | 1467 | WP_000264071.1 | IMP dehydrogenase | - |
| FORC27_RS01985 (FORC27_0390) | guaA | 429389..430930 (+) | 1542 | WP_000424963.1 | glutamine-hydrolyzing GMP synthase | - |
| FORC27_RS01990 (FORC27_0391) | - | 430998..432191 (-) | 1194 | WP_000237797.1 | site-specific integrase | - |
| FORC27_RS01995 (FORC27_0392) | - | 432218..432418 (-) | 201 | WP_000633907.1 | DUF3173 family protein | - |
| FORC27_RS02000 (FORC27_0393) | - | 432916..433146 (-) | 231 | WP_000845143.1 | helix-turn-helix domain-containing protein | - |
| FORC27_RS02005 (FORC27_0394) | - | 433143..433565 (-) | 423 | WP_000804879.1 | RNA polymerase sigma factor | - |
| FORC27_RS02010 (FORC27_0395) | - | 434096..434449 (+) | 354 | WP_001227350.1 | helix-turn-helix domain-containing protein | - |
| FORC27_RS14950 | - | 434507..434692 (-) | 186 | WP_413926387.1 | cysteine-rich KTR domain-containing protein | - |
| FORC27_RS02015 (FORC27_0396) | tet(M) | 434793..436712 (-) | 1920 | WP_000691737.1 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| FORC27_RS16045 | - | 436728..436844 (-) | 117 | WP_001791010.1 | tetracycline resistance determinant leader peptide | - |
| FORC27_RS02020 (FORC27_0397) | - | 437089..438018 (-) | 930 | WP_000584387.1 | conjugal transfer protein | - |
| FORC27_RS02025 (FORC27_0398) | - | 438035..439057 (-) | 1023 | WP_000768373.1 | bifunctional lytic transglycosylase/C40 family peptidase | - |
| FORC27_RS02030 (FORC27_0399) | - | 439054..441081 (-) | 2028 | WP_000192393.1 | CD3337/EF1877 family mobilome membrane protein | - |
| FORC27_RS02035 (FORC27_0400) | - | 441078..443531 (-) | 2454 | WP_000331165.1 | ATP-binding protein | - |
| FORC27_RS02040 (FORC27_0401) | - | 443515..443910 (-) | 396 | WP_000723887.1 | conjugal transfer protein | - |
| FORC27_RS02045 (FORC27_0402) | - | 443982..444620 (-) | 639 | WP_000248477.1 | DUF6037 family protein | - |
| FORC27_RS02050 (FORC27_0403) | - | 444676..445176 (-) | 501 | WP_000425404.1 | antirestriction protein ArdA | - |
| FORC27_RS02055 (FORC27_0404) | - | 445237..446016 (-) | 780 | WP_000675717.1 | abortive infection family protein | - |
| FORC27_RS02060 (FORC27_0405) | - | 446058..446279 (-) | 222 | WP_001009054.1 | hypothetical protein | - |
| FORC27_RS02065 (FORC27_0406) | - | 446276..446566 (-) | 291 | WP_000055376.1 | hypothetical protein | - |
| FORC27_RS02070 (FORC27_0407) | mobT | 446563..447747 (-) | 1185 | WP_000426689.1 | MobT family relaxase | - |
| FORC27_RS02075 (FORC27_0408) | - | 447929..449332 (-) | 1404 | WP_001130244.1 | FtsK/SpoIIIE domain-containing protein | - |
| FORC27_RS02080 (FORC27_0409) | - | 449354..450127 (-) | 774 | WP_000185761.1 | hypothetical protein | - |
| FORC27_RS02085 (FORC27_0410) | - | 450137..450514 (-) | 378 | WP_001234191.1 | YdcP family protein | - |
| FORC27_RS02090 (FORC27_0411) | - | 450535..450849 (-) | 315 | WP_000421279.1 | YdcP family protein | - |
Sequence
Protein
Download Length: 167 a.a. Molecular weight: 18539.12 Da Isoelectric Point: 4.7305
>NTDB_id=156515 FORC27_RS01855 WP_000934799.1 407076..407579(+) (ssbA) [Staphylococcus aureus strain FORC_027]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
Nucleotide
Download Length: 504 bp
>NTDB_id=156515 FORC27_RS01855 WP_000934799.1 407076..407579(+) (ssbA) [Staphylococcus aureus strain FORC_027]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.341 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.971 |
100 |
0.563 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
63.473 |
0.371 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.365 |