Detailed information
Overview
| Name | pilE | Type | Machinery gene |
| Locus tag | WX60_RS15815 | Genome accession | NZ_CP012027 |
| Coordinates | 1612338..1612433 (-) | Length | 31 a.a. |
| NCBI ID | WP_407716431.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain FA6140 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1607338..1617433
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WX60_RS08750 (WX60_01659) | msrAB | 1607564..1609132 (-) | 1569 | WP_003696288.1 | bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB | - |
| WX60_RS08755 (WX60_01660) | pilA | 1609278..1610531 (+) | 1254 | WP_003696286.1 | signal recognition particle-docking protein FtsY | Machinery gene |
| WX60_RS08760 (WX60_01661) | - | 1610914..1611255 (-) | 342 | Protein_1629 | pilin | - |
| WX60_RS08765 (WX60_01662) | pilE | 1611237..1611749 (-) | 513 | WP_048589560.1 | pilin | Machinery gene |
| WX60_RS08770 | - | 1612120..1612263 (-) | 144 | WP_010361012.1 | hypothetical protein | - |
| WX60_RS15815 | pilE | 1612338..1612433 (-) | 96 | WP_407716431.1 | hypothetical protein | Machinery gene |
| WX60_RS08775 (WX60_01663) | - | 1612598..1612981 (-) | 384 | Protein_1633 | pilin | - |
| WX60_RS08780 (WX60_01664) | - | 1613099..1613503 (-) | 405 | Protein_1634 | pilin | - |
| WX60_RS08785 (WX60_01665) | lpxC | 1613632..1614555 (-) | 924 | WP_003687007.1 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | - |
| WX60_RS08790 (WX60_01666) | - | 1615269..1615610 (-) | 342 | Protein_1636 | pilin | - |
| WX60_RS08795 (WX60_01667) | pilE | 1615592..1615888 (-) | 297 | WP_003691975.1 | pilin | Machinery gene |
| WX60_RS08800 (WX60_01668) | - | 1615945..1616322 (-) | 378 | Protein_1638 | pilin | - |
| WX60_RS08805 (WX60_01669) | - | 1616430..1616825 (-) | 396 | Protein_1639 | pilin | - |
| WX60_RS08810 (WX60_01670) | - | 1616852..1617202 (-) | 351 | Protein_1640 | pilin | - |
Sequence
Protein
Download Length: 31 a.a. Molecular weight: 3265.71 Da Isoelectric Point: 4.4788
>NTDB_id=150623 WX60_RS15815 WP_407716431.1 1612338..1612433(-) (pilE) [Neisseria gonorrhoeae strain FA6140]
MAEGQKSAVAGYCLNNGEWPENFVIPAKAGI
MAEGQKSAVAGYCLNNGEWPENFVIPAKAGI
Nucleotide
Download Length: 96 bp
>NTDB_id=150623 WX60_RS15815 WP_407716431.1 1612338..1612433(-) (pilE) [Neisseria gonorrhoeae strain FA6140]
TTGGCCGAAGGTCAAAAATCAGCCGTTGCCGGGTATTGCCTGAATAACGGCGAATGGCCGGAAAACTTCGTCATTCCCGC
GAAAGCGGGAATCTAG
TTGGCCGAAGGTCAAAAATCAGCCGTTGCCGGGTATTGCCTGAATAACGGCGAATGGCCGGAAAACTTCGTCATTCCCGC
GAAAGCGGGAATCTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilE | Neisseria gonorrhoeae MS11 |
72.727 |
70.968 |
0.516 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
63.636 |
70.968 |
0.452 |