Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ABU16_RS17125 Genome accession   NZ_CP011882
Coordinates   3331187..3331561 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis strain TO-A JPC     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3326187..3336561
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABU16_RS17085 (ABU16_3395) yqhG 3326519..3327313 (+) 795 WP_003230200.1 YqhG family protein -
  ABU16_RS17090 (ABU16_3396) sinI 3327496..3327669 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  ABU16_RS17095 (ABU16_3397) sinR 3327703..3328038 (+) 336 WP_080287687.1 transcriptional regulator SinR Regulator
  ABU16_RS17100 (ABU16_3398) tasA 3328131..3328916 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  ABU16_RS17105 (ABU16_3399) sipW 3328980..3329552 (-) 573 WP_003230181.1 signal peptidase I -
  ABU16_RS17110 (ABU16_3400) tapA 3329536..3330297 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  ABU16_RS17115 (ABU16_3401) yqzG 3330569..3330895 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABU16_RS17120 (ABU16_3402) spoIIT 3330937..3331116 (-) 180 WP_003230176.1 YqzE family protein -
  ABU16_RS17125 (ABU16_3403) comGG 3331187..3331561 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ABU16_RS17130 (ABU16_3404) comGF 3331562..3331945 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ABU16_RS17135 (ABU16_3405) comGE 3331971..3332318 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ABU16_RS17140 (ABU16_3406) comGD 3332302..3332733 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ABU16_RS17145 (ABU16_3407) comGC 3332723..3333019 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ABU16_RS17150 (ABU16_3408) comGB 3333033..3334070 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  ABU16_RS17155 (ABU16_3409) comGA 3334057..3335127 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ABU16_RS22935 (ABU16_3410) - 3335338..3335463 (-) 126 WP_003230155.1 hypothetical protein -
  ABU16_RS17170 (ABU16_3411) corA 3335529..3336482 (-) 954 WP_032677123.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=149197 ABU16_RS17125 WP_003230170.1 3331187..3331561(-) (comGG) [Bacillus subtilis strain TO-A JPC]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=149197 ABU16_RS17125 WP_003230170.1 3331187..3331561(-) (comGG) [Bacillus subtilis strain TO-A JPC]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment