Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ABU16_RS17090 Genome accession   NZ_CP011882
Coordinates   3327496..3327669 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain TO-A JPC     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3322496..3332669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABU16_RS17075 (ABU16_3393) gcvT 3323295..3324383 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  ABU16_RS17080 (ABU16_3394) yqhH 3324825..3326498 (+) 1674 WP_003230203.1 SNF2-related protein -
  ABU16_RS17085 (ABU16_3395) yqhG 3326519..3327313 (+) 795 WP_003230200.1 YqhG family protein -
  ABU16_RS17090 (ABU16_3396) sinI 3327496..3327669 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  ABU16_RS17095 (ABU16_3397) sinR 3327703..3328038 (+) 336 WP_080287687.1 transcriptional regulator SinR Regulator
  ABU16_RS17100 (ABU16_3398) tasA 3328131..3328916 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  ABU16_RS17105 (ABU16_3399) sipW 3328980..3329552 (-) 573 WP_003230181.1 signal peptidase I -
  ABU16_RS17110 (ABU16_3400) tapA 3329536..3330297 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  ABU16_RS17115 (ABU16_3401) yqzG 3330569..3330895 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ABU16_RS17120 (ABU16_3402) spoIIT 3330937..3331116 (-) 180 WP_003230176.1 YqzE family protein -
  ABU16_RS17125 (ABU16_3403) comGG 3331187..3331561 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ABU16_RS17130 (ABU16_3404) comGF 3331562..3331945 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ABU16_RS17135 (ABU16_3405) comGE 3331971..3332318 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=149195 ABU16_RS17090 WP_003230187.1 3327496..3327669(+) (sinI) [Bacillus subtilis strain TO-A JPC]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=149195 ABU16_RS17090 WP_003230187.1 3327496..3327669(+) (sinI) [Bacillus subtilis strain TO-A JPC]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment