Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AS588_RS14485 | Genome accession | NZ_CP014700 |
| Coordinates | 3022596..3022736 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain S499 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3017596..3027736
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AS588_RS14460 (AS588_14460) | - | 3017936..3018319 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| AS588_RS14465 (AS588_14465) | comA | 3018341..3018985 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| AS588_RS14470 (AS588_14470) | comP | 3019066..3021357 (-) | 2292 | WP_015387784.1 | histidine kinase | Regulator |
| AS588_RS14475 (AS588_14475) | comX | 3021369..3021533 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| AS588_RS14480 (AS588_14480) | comQ | 3021533..3022444 (-) | 912 | WP_014305720.1 | polyprenyl synthetase family protein | Regulator |
| AS588_RS14485 (AS588_14485) | degQ | 3022596..3022736 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| AS588_RS14490 (AS588_14490) | - | 3023202..3023543 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| AS588_RS14495 (AS588_14495) | - | 3023550..3024770 (-) | 1221 | WP_015387782.1 | EAL and HDOD domain-containing protein | - |
| AS588_RS14500 (AS588_14500) | - | 3024900..3026366 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| AS588_RS14505 (AS588_14505) | - | 3026384..3026935 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| AS588_RS14510 (AS588_14510) | - | 3027032..3027430 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=149198 AS588_RS14485 WP_003152043.1 3022596..3022736(-) (degQ) [Bacillus amyloliquefaciens strain S499]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=149198 AS588_RS14485 WP_003152043.1 3022596..3022736(-) (degQ) [Bacillus amyloliquefaciens strain S499]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |