Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ABH13_RS11870 Genome accession   NZ_CP011686
Coordinates   2501500..2501877 (-) Length   125 a.a.
NCBI ID   WP_032866434.1    Uniprot ID   -
Organism   Bacillus velezensis strain G341     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2496500..2506877
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABH13_RS11830 (ABH13_2398) - 2496998..2497792 (+) 795 WP_007408330.1 YqhG family protein -
  ABH13_RS11835 (ABH13_2399) sinI 2497969..2498142 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ABH13_RS11840 (ABH13_2400) sinR 2498176..2498511 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABH13_RS11845 (ABH13_2401) tasA 2498559..2499344 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ABH13_RS11850 (ABH13_2402) sipW 2499409..2499993 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ABH13_RS11855 (ABH13_2403) tapA 2499965..2500636 (-) 672 WP_047935952.1 amyloid fiber anchoring/assembly protein TapA -
  ABH13_RS11860 (ABH13_2404) - 2500895..2501224 (+) 330 WP_047935954.1 DUF3889 domain-containing protein -
  ABH13_RS11865 (ABH13_2405) - 2501264..2501443 (-) 180 WP_003153093.1 YqzE family protein -
  ABH13_RS11870 (ABH13_2406) comGG 2501500..2501877 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABH13_RS11875 (ABH13_2407) comGF 2501878..2502378 (-) 501 WP_257645080.1 competence type IV pilus minor pilin ComGF -
  ABH13_RS11880 (ABH13_2408) comGE 2502287..2502601 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  ABH13_RS11885 (ABH13_2409) comGD 2502585..2503022 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABH13_RS11890 (ABH13_2410) comGC 2503012..2503320 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ABH13_RS11895 (ABH13_2411) comGB 2503325..2504362 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABH13_RS11900 (ABH13_2412) comGA 2504349..2505419 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  ABH13_RS11905 (ABH13_2413) - 2505611..2506561 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14197.08 Da        Isoelectric Point: 9.7381

>NTDB_id=147457 ABH13_RS11870 WP_032866434.1 2501500..2501877(-) (comGG) [Bacillus velezensis strain G341]
MYKSDGFIYPAVLFVSAAVLLVISYTTSDFITRKTFAKEAGEYWTGENLLQNGALLSSRHMTQGQRVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=147457 ABH13_RS11870 WP_032866434.1 2501500..2501877(-) (comGG) [Bacillus velezensis strain G341]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTAC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAGGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGGCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment