Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABH13_RS11835 | Genome accession | NZ_CP011686 |
| Coordinates | 2497969..2498142 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain G341 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2492969..2503142
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABH13_RS11820 (ABH13_2396) | gcvT | 2493782..2494882 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABH13_RS11825 (ABH13_2397) | - | 2495306..2496976 (+) | 1671 | WP_007408331.1 | DEAD/DEAH box helicase | - |
| ABH13_RS11830 (ABH13_2398) | - | 2496998..2497792 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| ABH13_RS11835 (ABH13_2399) | sinI | 2497969..2498142 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ABH13_RS11840 (ABH13_2400) | sinR | 2498176..2498511 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ABH13_RS11845 (ABH13_2401) | tasA | 2498559..2499344 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ABH13_RS11850 (ABH13_2402) | sipW | 2499409..2499993 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ABH13_RS11855 (ABH13_2403) | tapA | 2499965..2500636 (-) | 672 | WP_047935952.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABH13_RS11860 (ABH13_2404) | - | 2500895..2501224 (+) | 330 | WP_047935954.1 | DUF3889 domain-containing protein | - |
| ABH13_RS11865 (ABH13_2405) | - | 2501264..2501443 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ABH13_RS11870 (ABH13_2406) | comGG | 2501500..2501877 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ABH13_RS11875 (ABH13_2407) | comGF | 2501878..2502378 (-) | 501 | WP_257645080.1 | competence type IV pilus minor pilin ComGF | - |
| ABH13_RS11880 (ABH13_2408) | comGE | 2502287..2502601 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| ABH13_RS11885 (ABH13_2409) | comGD | 2502585..2503022 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=147455 ABH13_RS11835 WP_003153105.1 2497969..2498142(+) (sinI) [Bacillus velezensis strain G341]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=147455 ABH13_RS11835 WP_003153105.1 2497969..2498142(+) (sinI) [Bacillus velezensis strain G341]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |