Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   AA977_RS00200 Genome accession   NZ_CP011486
Coordinates   37578..37691 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori strain K26A1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32578..42691
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AA977_RS00175 (AA977_00180) - 32631..34853 (+) 2223 WP_064434115.1 ATP-dependent Clp protease ATP-binding subunit -
  AA977_RS00180 (AA977_00185) panD 34843..35193 (+) 351 WP_064434116.1 aspartate 1-decarboxylase -
  AA977_RS00185 (AA977_00190) - 35204..35497 (+) 294 WP_000347932.1 YbaB/EbfC family nucleoid-associated protein -
  AA977_RS00190 (AA977_00195) - 35497..36492 (+) 996 WP_064434117.1 PDZ domain-containing protein -
  AA977_RS00195 (AA977_00200) comB6 36498..37562 (+) 1065 WP_064435164.1 P-type conjugative transfer protein TrbL Machinery gene
  AA977_RS00200 (AA977_00205) comB7 37578..37691 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  AA977_RS00205 (AA977_00210) comB8 37688..38431 (+) 744 WP_064434118.1 virB8 family protein Machinery gene
  AA977_RS00210 (AA977_00215) comB9 38431..39408 (+) 978 WP_064434119.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  AA977_RS00215 (AA977_00220) comB10 39401..40543 (+) 1143 WP_064434120.1 DNA type IV secretion system protein ComB10 Machinery gene
  AA977_RS00220 (AA977_00225) - 40609..42021 (+) 1413 WP_064434121.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=146273 AA977_RS00200 WP_001217877.1 37578..37691(+) (comB7) [Helicobacter pylori strain K26A1]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=146273 AA977_RS00200 WP_001217877.1 37578..37691(+) (comB7) [Helicobacter pylori strain K26A1]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACGAGCAAGGTGCATGAAATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAACCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment