Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   AA976_RS00475 Genome accession   NZ_CP011484
Coordinates   89014..89127 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori strain CC33C     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 84014..94127
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AA976_RS00450 (AA976_00450) - 84061..86289 (+) 2229 WP_064436167.1 AAA family ATPase -
  AA976_RS00455 (AA976_00455) panD 86279..86632 (+) 354 WP_000142288.1 aspartate 1-decarboxylase -
  AA976_RS00460 (AA976_00460) - 86635..86937 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  AA976_RS00465 (AA976_00465) - 86931..87935 (+) 1005 WP_064436168.1 PDZ domain-containing protein -
  AA976_RS00470 (AA976_00470) comB6 87943..88998 (+) 1056 WP_064436169.1 P-type conjugative transfer protein TrbL Machinery gene
  AA976_RS00475 (AA976_00475) comB7 89014..89127 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  AA976_RS00480 (AA976_00480) comB8 89124..89867 (+) 744 WP_064436170.1 type IV secretion system protein Machinery gene
  AA976_RS00485 (AA976_00485) comB9 89867..90838 (+) 972 WP_064436171.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  AA976_RS00490 (AA976_00490) comB10 90831..91967 (+) 1137 WP_064436172.1 DNA type IV secretion system protein ComB10 Machinery gene
  AA976_RS00495 (AA976_00495) - 92037..93449 (+) 1413 WP_064436173.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=146232 AA976_RS00475 WP_001217877.1 89014..89127(+) (comB7) [Helicobacter pylori strain CC33C]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=146232 AA976_RS00475 WP_001217877.1 89014..89127(+) (comB7) [Helicobacter pylori strain CC33C]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGCTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAATAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment